KEGG   Nasonia vitripennis (jewel wasp): 100119613
Entry
100119613         CDS       T01081                                 

Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04150  mTOR signaling pathway
nvi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100119613
   04150 mTOR signaling pathway
    100119613
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nvi00536]
    100119613
Glycosaminoglycan binding proteins [BR:nvi00536]
 Heparan sulfate / Heparin
  Morphogens
   100119613
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100119613
NCBI-ProteinID: XP_001603351
NASONIABASE: NV18282
Position
5
AA seq 356 aa
MEMRPVLLAVCLLLVSPVALSFWTVGNQLVMDPMLVCKKTRRLKGKLGDICRKEPALLKQ
ITKGMQVGTKECQYQFRNRRWNCTTYRRSLKKIILRDTRETGFVNAITAAGVTYAVTRAC
TMGDLVECSCEKMTPKSSRYGKLGRLASRSKHLPTDGDWEWGGCGDNVNFGFKKSREFMD
APYRRRSDIKTLLKRHNNDAGRLAVRNFMRTECKCHGLSGSCTVRTCWRKMPPFREVGNR
LKESFDGAAKVIPGNDGHSFITEGLTIKPPGRFDLIYSEDSPDFCRANRKTGALGTQGRQ
CNATSQGVDGCELLCCGRGYDTRIIKEKVNCQCRFRWCCDVTCNTCIVKKTLNTCR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaaatgcgccccgtcctcctggcggtctgcctcctgcttgtcagccccgtcgccctg
tctttctggaccgtaggcaatcagctggtgatggacccgatgctcgtgtgcaagaagacg
cgacgtctgaagggaaagctcggcgacatctgccgcaaggagccggctctgctgaagcag
atcaccaagggcatgcaggtgggcacgaaggagtgtcagtatcagtttcggaaccgtagg
tggaactgcacgacgtacaggaggtcgctgaagaaaataatactgcgcgataccagggaa
accggcttcgtcaatgccatcacggcggccggcgtgacttacgccgtgacgagggcctgc
accatgggcgacctcgtcgagtgctcctgcgagaagatgacccccaagagtagtcgatac
ggaaagctcggaagactcgccagccggagtaaacacttgcctacggacggcgactgggag
tggggtggctgcggggacaacgtcaatttcggattcaaaaagtccagggagttcatggac
gcgccttacaggaggcgcagcgatatcaagacgcttctcaagcgtcacaataacgatgct
ggtcgattggcggtgcgaaacttcatgcgcacagagtgcaagtgccacgggctctcgggt
tcttgtacagtgcgcacctgttggcgcaagatgcctcccttccgcgaggtgggcaaccgg
ttgaaggagtccttcgacggcgcggccaaggtaataccgggcaacgacggccacagcttc
atcaccgagggcctgacgatcaaaccaccgggtcgctttgacctcatctacagcgaggac
tcgccggacttttgccgggcgaatcgaaagaccggcgcgctaggcacgcagggccgacag
tgcaacgccacctctcagggcgtcgacggctgcgagctgctgtgctgcggacgaggctac
gacaccaggatcatcaaggagaaggtcaactgtcagtgcaggttcaggtggtgctgcgac
gtcacctgcaacacctgcatcgttaaaaagacgctcaatacgtgccgctag

DBGET integrated database retrieval system