KEGG   Nasonia vitripennis (jewel wasp): 100121621
Entry
100121621         CDS       T01081                                 
Name
(RefSeq) allantoinase
  KO
K01466  allantoinase [EC:3.5.2.5]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00230  Purine metabolism
nvi01100  Metabolic pathways
Module
nvi_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100121621
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.5  allantoinase
     100121621
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 DUF6282 HEPN_Apea
Other DBs
NCBI-GeneID: 100121621
NCBI-ProteinID: XP_032456098
NASONIABASE: NV12232
Position
5
AA seq 320 aa
MNASGAKLFVSRQTVLPDGVKAAVLLVKNGKIEAIHPCANDNEINDKLGQHSNVEYEDFG
NLLLMPGIVDSHVHVNEPGRSEWEGFWTATKAAAAGGVTTIVDMPLNSIPPTTTVENLKT
KAQVARTKAFVDIGFWGGVIPGNQKDLKPLVEAGVVGFKCFLCPSCIEEFPHVNEEDVEK
ALMELRNLNTVLAFHAECELKDAIDKSKEDPSVYHTYLQTRPEIMEVNAITIITKLCKAY
NVRCHIVHLSAAEALGLVREAKKNKLRLTAETCYHYLYLTAEKIPRNATQFKCCPPIRDE
SNRVSKFIFNLQFAKLQTLV
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaatgcatctggtgcaaaattattcgtatcaaggcagactgttctaccggacggtgtc
aaagccgctgttctactggtgaaaaatggaaaaatcgaggcgatccatccttgcgccaat
gacaacgaaatcaacgataaacttggacaacattcgaacgtcgaatacgaagattttgga
aatttgctcttgatgcctggaatagtcgactctcacgtgcacgtgaatgaacccggccgc
agcgagtgggaaggcttttggacggctacgaaagccgctgctgccggcggcgttactacc
attgttgacatgccactgaattccataccacctacaactaccgtagagaatttgaaaact
aaagctcaggtggctcgaacaaaagctttcgtggacatcggattctggggtggcgtcata
ccaggaaaccaaaaagacttgaagccactcgtggaagccggagtcgtcgggttcaagtgc
ttcctgtgtcccagttgcattgaagagtttccccacgtcaatgaggaggatgtggaaaaa
gccttgatggagttgcggaatttaaacaccgtcttagcctttcacgcggaatgcgagtta
aaagatgctatcgataaatcaaaagaagacccgtcggtttaccatacctacttgcagact
cgtcctgagatcatggaagttaacgcaataacgattatcactaagctgtgcaaagcttac
aacgttcgttgtcacatagtacacttatctgcagccgaggctttgggcttggttagggag
gcgaaaaagaataaattgcggctgactgcggaaacctgttatcattatctctacctgacc
gccgaaaaaatcccacggaatgccacgcagtttaagtgctgtccgccaattagagatgaa
agcaacagagttagtaaattcatctttaatcttcaattcgcaaaattacaaacgctcgtt
tag

DBGET integrated database retrieval system