KEGG   Nasonia vitripennis (jewel wasp): 100121847
Entry
100121847         CDS       T01081                                 

Definition
(RefSeq) putative phosphatidate phosphatase isoform X1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00561  Glycerolipid metabolism
nvi00564  Glycerophospholipid metabolism
nvi00565  Ether lipid metabolism
nvi00600  Sphingolipid metabolism
nvi01100  Metabolic pathways
Module
nvi_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100121847
   00564 Glycerophospholipid metabolism
    100121847
   00565 Ether lipid metabolism
    100121847
   00600 Sphingolipid metabolism
    100121847
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     100121847
SSDB
Motif
Pfam: PAP2 LrgB DUF5353 NDUF_B4 DUF5527
Other DBs
NCBI-GeneID: 100121847
NCBI-ProteinID: XP_001605457
NASONIABASE: NV16393
Position
5
AA seq 332 aa
MDRSSKFVLRKIVIDFVCLFVVGMTVLMFYLFGKPYERGFFCNDESLSHPFHDSTVTSPM
LYVIGLFLPICTMMVFEFSHWKRVSSSAPLVLFGFNIPSWMSAAYTKIGMFGFGAAITVL
TTDVAKYTVGRLRPHFLTLCQPNIDCSLPQNQHRYIEDFECTASGVSKKLLKELRLSFPS
GHSSFSAYTMVYLALYLQLRLTWKGSKLLRHLLQFICIMMAWFTAMTRISNYKHHWSDVL
AGSTIGTVIALIMVFGVADLFKERRSSDDSRIRAGSQQQQQQQHEEKVRAVDYEVAASSE
GTQLESTPLRSESPNYGGISISEELGSTRRNR
NT seq 999 nt   +upstreamnt  +downstreamnt
atggaccgcagctcgaagttcgtgctgcgcaagatcgtcatcgacttcgtctgcctgttc
gtcgtgggcatgacggtgctgatgttctacctgttcggcaaaccgtacgagcggggcttc
ttctgcaacgacgagtcgctaagccacccgttccacgactctacggtcaccagtccaatg
ctctacgtcatcgggcttttccttccaatctgcacgatgatggtgttcgagttcagtcac
tggaagagggtgagcagttcggcgccgctggtactttttggcttcaacattccgtcttgg
atgagcgccgcttatactaagatcgggatgttcggcttcggagctgcgatcacggtgctg
acgaccgacgtggccaagtacacggtgggaaggctgcggccgcactttctgaccctctgc
cagccgaacatcgactgcagcctgccgcagaaccaacaccgctacatcgaggatttcgag
tgcacggcctccggggtctccaaaaagttgctcaaggaactcaggctgtccttcccttcg
gggcactcatccttctcggcctacaccatggtctacttagcgctttacctgcaactgcga
ctcacgtggaagggcagtaagctgctgaggcacttgctgcagttcatctgcatcatgatg
gcatggttcacggcgatgacgcggatctcgaactacaagcatcactggagcgacgtcctc
gccggctcgaccatagggactgtcatcgctcttatcatggtattcggcgtagctgacctc
ttcaaggagcgacgatcaagcgacgacagccgcatacgcgcgggctcccagcaacagcag
cagcaacaacacgaggagaaggtgcgcgcggtcgactacgaggtggccgcatcatccgag
ggcacgcagctcgaatccaccccattgagaagtgaatctccaaactatggtggtattagc
atctcggaagaattgggaagtactcgacgaaacagatga

DBGET integrated database retrieval system