KEGG   Ovis aries (sheep): 443460Help
Entry
443460            CDS       T03117                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00590  Arachidonic acid metabolism
oas01100  Metabolic pathways
oas04064  NF-kappa B signaling pathway
oas04370  VEGF signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04668  TNF signaling pathway
oas04723  Retrograde endocannabinoid signaling
oas04726  Serotonergic synapse
oas04913  Ovarian steroidogenesis
oas04921  Oxytocin signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas05140  Leishmaniasis
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05204  Chemical carcinogenesis
oas05206  MicroRNAs in cancer
oas05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    443460 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    443460 (PTGS2)
   04064 NF-kappa B signaling pathway
    443460 (PTGS2)
   04668 TNF signaling pathway
    443460 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    443460 (PTGS2)
   04657 IL-17 signaling pathway
    443460 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    443460 (PTGS2)
   04913 Ovarian steroidogenesis
    443460 (PTGS2)
   04921 Oxytocin signaling pathway
    443460 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    443460 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    443460 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443460 (PTGS2)
   05206 MicroRNAs in cancer
    443460 (PTGS2)
   05204 Chemical carcinogenesis
    443460 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    443460 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    443460 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    443460 (PTGS2)
   05165 Human papillomavirus infection
    443460 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    443460 (PTGS2)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     443460 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 443460
NCBI-ProteinID: NP_001009432
Ensembl: ENSOARG00000007592
UniProt: P79208
Position
12
AA seq 603 aa AA seqDB search
MLARALLLCAAVVCGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFLT
RIKLLLKPTPDTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHYS
YKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGTN
LMFAFFAQHFTHQFFKTDIERGPAFTKGKNHGVDLSHVYGESLERQHNRRLFKDGKMKYQ
MINGEMYPPTVKDTQVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCDV
LKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQN
RIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQFVESFTRQIAGRVA
GRRNLPAAVEKVSKASLDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEALY
GDIDAMELYPALLVEKPAPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEVG
FKIINTASIQSLICSNVKGCPFTSFSVQDAHLTKTVTINASSSHSGLDDINPTVLLKERS
TEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgctctgcgccgccgtggtctgcggtgcagcaaatccttgc
tgttcccatccatgccagaatcgaggtgtatgtatgagtgtaggattcgaccagtacaaa
tgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctgaca
agaataaaattactcctgaaacccactcccgacacagtgcactacatacttacccacttc
aagggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgagatat
gtgttgacgtcgagatcacatttgattgagagtccgccaacttataatgtgcactacagc
tataaaagctgggaagccttttctaacctgtcctattataccagagctcttcctcctgtg
cctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattcgaaa
gaagttgtgaaaaaagtacttctaagaagaaagttcattcctgatccccagggcacaaat
ctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatattgaa
cgaggaccagctttcaccaagggaaagaaccatggggtggacttaagtcatgtttatggt
gaatctttagagagacagcataaccgtcgccttttcaaggatggaaaaatgaaatatcag
atgattaatggagagatgtatcctcccactgtcaaagatactcaggttgaaatgatctac
ccgcctcatattcctgaacacttgaagtttgctgtgggccaggaggtctttggtctggtg
cctggtctgatgatgtatgccaccatttggctgcgggaacacaacagagtgtgtgatgtg
cttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagtaggctaatc
ctgataggagaaactattaagattgtgattgaagactacgtacagcacttgagtggctat
cacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccaaaac
cgtattgctgctgagtttaacacgctctaccactggcatccccttctgcctgacgtcttt
cagattgatggccaggagtacaactatcagcagtttatctataacaactctgtcttactg
gaacatggtgtcactcagtttgttgaatcatttaccaggcaaattgctggcagggtcgct
ggtcgtaggaatcttccagccgcagtagagaaagtatcaaaggcttcacttgaccagagc
agagagatgaaataccagtcttttaatgagtatcgcaaacgttttctgctgaagccctat
gaatcttttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctctac
ggagacatagatgccatggagctgtatcccgcccttctggtagagaagcccgctcccgac
gccatctttggggagaccatggtagaagccggagcaccattctccctgaaaggacttatg
ggtaatcctatatgttctcctgagtactggaagcctagcacttttggtggagaagtaggt
tttaaaatcatcaacactgcctcaattcagtctctcatctgcagtaacgtgaaaggctgt
ccctttacctcattcagtgttcaagatgcacacctcaccaaaacagtcaccattaacgca
agctcttcccactcgggactagacgatatcaaccccacagtcctactaaaggagcgttca
accgaactgtag

DBGET integrated database retrieval system