KEGG   Oryctolagus cuniculus (rabbit): 100101555Help
Entry
100101555         CDS       T03373                                 

Gene name
CACNA1C, CACB
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04260  Cardiac muscle contraction
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04742  Taste transduction
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04929  GnRH secretion
ocu04930  Type II diabetes mellitus
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05010  Alzheimer disease
ocu05031  Amphetamine addiction
ocu05410  Hypertrophic cardiomyopathy (HCM)
ocu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ocu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100101555 (CACNA1C)
   04020 Calcium signaling pathway
    100101555 (CACNA1C)
   04024 cAMP signaling pathway
    100101555 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100101555 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100101555 (CACNA1C)
   04929 GnRH secretion
    100101555 (CACNA1C)
   04912 GnRH signaling pathway
    100101555 (CACNA1C)
   04921 Oxytocin signaling pathway
    100101555 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100101555 (CACNA1C)
   04924 Renin secretion
    100101555 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100101555 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100101555 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100101555 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100101555 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100101555 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100101555 (CACNA1C)
   04727 GABAergic synapse
    100101555 (CACNA1C)
   04725 Cholinergic synapse
    100101555 (CACNA1C)
   04728 Dopaminergic synapse
    100101555 (CACNA1C)
   04726 Serotonergic synapse
    100101555 (CACNA1C)
   04720 Long-term potentiation
    100101555 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100101555 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100101555 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100101555 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100101555 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100101555 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100101555 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100101555 (CACNA1C)
   05414 Dilated cardiomyopathy (DCM)
    100101555 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100101555 (CACNA1C)
   04934 Cushing syndrome
    100101555 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100101555 (CACNA1C)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100101555 (CACNA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Etmic-2
Motif
Other DBs
NCBI-GeneID: 100101555
NCBI-ProteinID: NP_001129994
UniProt: P15381
Structure
PDB: 

Position
8
AA seq 2171 aa AA seqDB search
MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGVADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVGKPALEEAKEEKIELKSIT
ADGESPPTTKINMDDLQPNESEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLI
VIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDSRSAFPQTFTTQRPLHISKAGNNQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTALGRLPRPAGYPSTVSTVEGHGSPLSPAVRAQEAAWKLSSKRCHSQESQIAMACQEG
ASQDDNYDVRIGEDAECCSEPSLLSTEMLSYQDDENRQLAPPEEEKRDIRLSPKKGFLRS
ASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTSLPR
PCATPPATPGSRGWPPQPIPTLRLEGADSSEKLNSSFPSIHCGSWSGENSPCRGDSSAAR
RARPVSLTVPSQAGAQGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDL
TIEEMENAADDILSGGARQSPNGTLLPFVNRRDPGRDRAGQNEQDASGACAPGCGQSEEA
LADRRAGVSSL
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagcccttgttcagccagctacgcccgcataccagccgctgcctagccacctg
tctgctgaaacggagagtacatgtaaaggtactgtggtgcatgaagctcaactcaaccat
ttctacatctctcctggaggttccaactatgggagcccacgcccagctcatgccaacatg
aatgccaacgcagctgcggggctcgcccctgagcacatccccaccccaggggcagccctg
tcctggcaggcagccatcgatgcggcccggcaggccaagctgatgggcagtgctggcaac
gcgactatctccaccgtcagctccacgcagcggaagcggcagcagtatgggaagcccaag
aagcagggcagcaccactgccactcgcccgccccgtgccctgctctgcctcaccctgaag
aaccccatccggagggcgtgcataagcatcgtcgagtggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcaatctatattccctttccagaagat
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
actgtggaagcatttttaaaagtaatagcctatggacttctgtttcaccccaacgcttac
ctccgcaatggctggaatttactagactttataattgtggttgtagggctttttagtgca
attttagaacaagcaaccaaagcagacggggccaatgccctaggagggaaaggggctgga
ttcgacgtgaaggcgctgagggctttccgcgtgctgcgccccctgcggctggtgtctgga
gtcccgagtctccaggtggtcctgaactccatcatcaaggccatggtccctctgctgcac
attgccctgctagtgctgtttgtcatcatcatctatgccatcatcggcctggagctcttc
atggggaagatgcacaagacatgctacaaccaggagggtgtagcagatgtcccagcagaa
gatgatccttccccttgtgctctggagacgggccacgggcggcagtgccagaacggcacc
gtgtgcaagcctgggtgggatggacccaagcacggcatcaccaactttgacaattttgct
ttcgccatgttgacggtgttccagtgtatcaccatggagggctggaccgacgtgctgtac
tggatgcaggacgctatgggctatgagctaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagggagaaggccaaagctcggggagatttccagaagttgcgggagaagcagcagctg
gaagaggacctcaaaggctacctggactggatcactcaggcagaagacatcgaccctgag
aatgaggatgaaggcatggatgaggagaaaccccgaaacatgagcatgcccacaagtgag
accgaatctgtcaacactgaaaacgtggctggaggtgacatcgaaggagaaaactgcggg
gccaggctggcccaccggatctccaagtcgaaattcagccgctactggcgccggtggaat
aggttctgcaggagaaagtgccgcgcagcggtcaagtcgaacgtcttctactggctggtg
atcttcctggtcttcctgaacacgctcaccattgcctctgagcactacaaccagccccac
tggctcacggaggtccaagacacggccaataaggctctactggccctgttcactgccgag
atgctgctgaagatgtacagcctgggcctgcaggcctatttcgtgtccctcttcaaccgc
ttcgactgcttcattgtgtgcgggggcatcctggagaccatcctggtggagaccaaggtc
atgtcccccctgggcatctctgtgctgagatgcgtgcggctcctgagaatattcaaaatt
acaaggtactggaactccttgagcaacctggtggcctccctgctgaactcggtgcgctcc
atcgcctccctgctcctgctcctcttcctcttcatcatcatcttctccctgctggggatg
cagctgtttggaggcaagttcaacttcgatgagatgcagacccggaggagcacgttcgac
aatttcccgcagtccctgctcaccgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaattatatcctactgaatgtgttcttggcc
attgctgtggacaacctggctgatgctgagagccttacttctgcccaaaaggaagaggaa
gaagagaaggagagaaagaagctggccaggactgccagcccggagaagaaacaagaggtg
gtagggaagccggccctggaggaggccaaggaggagaaaattgagctgaaatccattaca
gctgatggagagtccccgcctaccaccaagatcaacatggatgacctccagcccaatgag
agtgaggataagagtccctaccccaacccggaaaccacaggagaagaggatgaggaggag
cctgagatgcctgtcggcccccgccctcggccactctccgagctgcaccttaaggagaag
gccgtgcctatgccagaagccagtgcgtttttcatcttcagccccaacaacaggttccgc
ctccagtgtcaccgtatcgtcaacgacacgatcttcaccaacctgatcctcttcttcatt
ctgctcagcagcatttccctggctgccgaggaccctgtgcagcacacctccttcaggaat
cacattctgttttattttgacattgtttttactaccattttcaccattgaaattgctctc
aagatgactgcgtatggggccttcctgcacaagggctctttctgcaggaactacttcaac
atcctggacctgctggtggtcagcgtgtccctcatctccttcggcatccagtccagcgcg
atcaatgtcgtgaagatcttgcgagtgctgcgagtgctcaggccactgcgggccatcaac
agggccaaggggctaaagcacgtggttcagtgtgtgttcgtggccatccggaccattggg
aacatcgtgattgtcaccacgctgctgcagttcatgttcgcctgcatcggagtccagctc
ttcaaggggaagctgtacacctgttcagacagttccaaacagactgaggctgaatgcaag
ggtaactacatcacctacaaagatggagaggttgaccatcccatcatccagccgcgcagc
tgggagaacagcaagtttgactttgacaacgtcctggcagccatgatggccctcttcact
gtctccaccttcgagggctggccagagctgctgtaccgctccatcgactcccacacggaa
gacaagggccctatctacaactaccgagtggagatctccatcttcttcatcatctacatc
atcatcatcgccttcttcatgatgaacatcttcgtgggtttcgtcattgtcaccttccag
gagcagggggagcaggagtacaagaactgtgagctggacaagaaccagcggcagtgcgtg
gaatatgccctcaaggcccggcccctgcggaggtacatccccaagaaccagcaccagtac
aaagtgtggtacgtggtcaactccacctactttgagtacctgatgttcgtcctcatcctg
ctcaacaccatctgcttggccatgcagcactacggccagagctgcctgttcaaaatcgcc
atgaacatcctcaacatgctcttcaccggcctcttcaccgtggaaatgatcctgaagctc
attgccttcaaacccaagggttactttagtgatccctggaatgtttttgacttcctcatc
gtaattggcagcataattgacgtcattctcagtgagactaatccagctgaacatacccaa
tgctctccctctatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctg
ttccgggtcatgcgcctggtcaagctgctgagccgcggggagggcatccggacgctgctg
tggaccttcatcaagtccttccaggccctgccctatgtggctcttctgatcgtaatgctg
ttcttcatctatgctgtgatcgggatgcaggtgtttgggaaaatcgccctgaacgacacc
acggagatcaaccggaacaacaacttccagaccttcccccaagctgtgctgctcctcttc
aggtgtgccacgggggaggcttggcaggatatcatgctggcctgcatgccaggcaagaag
tgtgccccagagtctgagccccacaacagcacagaaggggagaccccctgcggcagcagc
ttcgccgtcttctacttcatcagcttctacatgctttgtgccttcctgatcatcaatctc
tttgtagctgtcatcatggacaactttgactacctgacaagggactggtcaatccttggt
ccccaccatctggatgaatttaaaagaatctgggcagagtatgaccctgaagccaagggt
cgtatcaaacacctggatgtggtgaccctcctccggcggattcagcccccactgggtttt
gggaagctgtgccctcaccgtgtggcttgcaaacgcctggtctccatgaacatgcctctg
aacagtgacgggacggtcatgttcaacgccaccctgtttgccctggtcaggacagctctg
aggatcaaaacagaaggaaacctggaacaagccaatgaggagctgcgggccatcatcaag
aagatctggaagcggaccagcatgaagctgctggaccaagtggtgccccctgcaggcgat
gatgaggtcacagtcggcaagttctacgctaccttcctgatccaagagtacttccggaaa
ttcaagaagcgcaaagagcaagggcttgtgggcaagccctcccagaggaatgccctttcc
ctgcaggctggcctgcgcactctgcacgacatcgggcctgagatccgacgggccatctcc
ggagacctgacagctgaggaagagctggacaaggccatgaaggaggctgtgtctgctgcc
tctgaagatgacatcttcaggagggccggtggcctgtttggcaaccatgtcagctactac
caaagtgacagccggagcgccttcccccagaccttcactacgcagcgcccactgcacatc
agcaaggctggcaacaaccaaggcgacaccgagtcaccctcccacgagaagctggtggac
tccactttcacccccagcagctactcgtccaccggctccaacgccaacatcaacaatgcc
aacaacactgccctgggccgcctcccccgccccgccggctaccccagcacagtcagcact
gtggagggccacgggtcccccttgtctcctgccgtccgggcacaggaggcagcatggaag
ctcagctccaagagatgccactcccaggagagccagatagccatggcgtgtcaggagggc
gcatcccaggacgacaactacgacgtgaggatcggtgaagatgcagagtgctgcagtgag
cccagcctgctctccacagagatgctctcctaccaggatgacgaaaaccgacaactggcg
cccccggaggaggagaagcgggacatcaggctgtctccaaagaagggtttcctgcgctcc
gcatcactgggtcgaagggcttccttccacctggagtgtctgaagcggcagaagaatcaa
gggggagacatctctcagaagacagtcctgcccctgcatctggtccaccaccaggcattg
gcagtggcgggcctgagtcccctcctgcagagaagccattcccccacctcgctccctagg
ccctgtgccacgccccctgccacaccgggcagccgaggctggcccccacagcccatcccc
accctgcggctggagggggccgactccagtgagaaactcaacagcagcttcccgtccatc
cactgcggctcatggtctggggagaacagcccctgcagaggggacagcagcgccgcccgg
agagcccggcccgtctccctcactgtgcccagccaggctggggcccaggggagacagttc
catggcagcgccagcagcctggtggaagcggtcttgatttccgaaggactggggcagttt
gctcaagatcccaagttcatcgaggtcacgacccaggagctggctgacgcctgcgatctg
accatagaggagatggagaacgcggccgacgacattctcagcgggggcgcccggcagagc
cccaatggcaccctgttaccctttgtgaaccgcagggacccgggccgggacagagcgggg
cagaacgagcaggacgcgagcggcgcatgcgccccagggtgcgggcagagcgaggaggcc
ctcgcggaccgcagggccggcgtcagcagcctgtag

DBGET integrated database retrieval system