KEGG   Oryctolagus cuniculus (rabbit): 100356614
Entry
100356614         CDS       T03373                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356614 (ANKRD53)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100356614 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 100356614
NCBI-ProteinID: XP_008252488
Ensembl: ENSOCUG00000008891
Position
2
AA seq 553 aa
MLDLQGSGPGGWGRKTSEAPGAAGRVPNTLGGSARSAAAALGAAQGRENQAPAPGRPGLS
RPLVGRERAGGSLAGKDGEQLSPDLLRLAPSGGHQVSLKVIGNTPESRLPSPIEESDQRV
FGNYYQLFAASVGDVEWLRFCLNQRRGEIEANDKGFAAIHLAAQQGQLTCLQVLIDEYEF
PVDLPTHGGETALHLVIHKDNEPVALPCIQYLLEKGANLDAQTHNGSTPLHLAACEGLLG
CVKVLVQRGANVHAQDALGCKPIDYCKMWNHRTCARFLKDAMWKRDKDDFAREMGKVKRL
KEQLALIELDYLTEYQKEHKVLREEDFTKWLRCKLFNQRHSLLTKDTQVASTRSRPTILP
KTSEYQGPQTSQSSQPWGKKQLGSIQQCPARLPTKPIYRRPPLRRPKMWNPSNNPASSPP
TQFSYPQGIRLGVHPDSCREQDFSSFLEVIPGPHGYAWLHTANGHWVAPVPRLPLEVMVR
ELYPQKQPYRMKVPQGFHAITIKDVPHKRHLDNRTFWTNTLAMSLRETFDEGFLANVRAH
RGLPALPTPTSPL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgctggacctccagggcagtggcccgggcgggtggggtcggaagacctcggaagcgccc
ggagcggccggccgggttcctaacaccctggggggctcggcccgcagcgctgcggcggcc
ctgggagcagcgcagggccgggagaaccaagctccagccccgggacggcctgggctctcg
cgccctctcgttgggcgggagcgggcaggcgggagcctggcggggaaggatggcgagcag
ctcagccccgacctgctccgcctggctccttccggcgggcatcaagtttccctgaaggtc
atcgggaataccccggagtccaggctgcccagccccatcgaggagtccgaccagagggtc
tttgggaactattatcagctgttcgcggcctcggtgggcgatgtggaatggctgcggttc
tgcttgaaccagcgccgcggggaaatcgaggccaacgacaagggcttcgctgctatccac
ttggcagcccagcagggccagctgacctgcctgcaggtcctgatagacgagtacgagttc
cccgtggacctgcccacccatggcggcgagacagccctgcacctcgtcatccacaaggac
aacgagcccgtggccctcccgtgcattcagtacctgctcgagaaaggggcgaacctcgat
gctcagacacacaatggctccacacccctgcacctggcagcttgcgagggcctgctgggc
tgtgtgaaggtactggtgcagaggggcgccaatgtccatgcccaagacgccttgggctgc
aaacccattgactactgcaagatgtggaaccaccgcacctgtgcccggttcttgaaggat
gccatgtggaaacgggacaaggatgactttgcccgtgagatggggaaagtgaagaggctc
aaggagcagctggccctcatagagctggactacctgactgagtaccaaaaggaacacaag
gttctgagagaggaggatttcaccaagtggctccgctgcaagttgttcaaccagcgccac
tctctgctcaccaaggatacgcaagtggccagtacccgatcccgccccaccatcctccct
aaaacctcagaataccaaggcccgcagacttcccagagctcccagccctgggggaagaaa
cagcttggaagcatacagcagtgcccggcgcggttgcccaccaagcccatctacaggcgg
cccccactcaggcggcccaaaatgtggaatcctagcaacaaccccgccagttctcccccg
acccagttcagctacccgcagggcatccgcctgggcgtgcatccagactcctgcagggag
caagacttcagcagcttcctggaggtgatccccggcccccatggctacgcatggctgcac
acggccaatggccactgggtggcgcccgtgccccggctgcctttggaggtgatggtccgc
gagctgtacccacagaagcagccgtacaggatgaaggtaccccagggctttcatgccatc
accatcaaggacgtgccccacaagcggcacttggacaaccgcaccttttggaccaacact
ctggccatgagcctgcgcgagacatttgacgaaggcttcctggccaacgtgcgagctcac
cgggggctccctgctctgcccacccccacaagccctctgtaa

DBGET integrated database retrieval system