KEGG   Oreochromis niloticus (Nile tilapia): 100692493Help
Entry
100692493         CDS       T06104                                 

Gene name
atg16l1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04136  Autophagy - other
onl04140  Autophagy - animal
onl04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100692493 (atg16l1)
   04136 Autophagy - other
    100692493 (atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100692493 (atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:onl04131]
    100692493 (atg16l1)
   03029 Mitochondrial biogenesis [BR:onl03029]
    100692493 (atg16l1)
Membrane trafficking [BR:onl04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100692493 (atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    100692493 (atg16l1)
Mitochondrial biogenesis [BR:onl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100692493 (atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 KASH_CCD DUF4472 HALZ
Motif
Other DBs
NCBI-GeneID: 100692493
NCBI-ProteinID: XP_005462785
Ensembl: ENSONIG00000017239
AA seq 605 aa AA seqDB search
MAERRGECLWKKHVAEQLKLRDREQRQAFEEIILQYNRLLEKADLQAVLSERYQADKYDV
QRGHESSAADSSRSDALQQEMAQMRIRHQEELTELHKKRGELAQSVIELNNQIQQKDREI
QNNEAKMLEYQQQISSLEGDCRELRSCLQDLERANQTLKDEYDALQITFSALEEKLRKTT
EDNQELVSRWMAEKAQEANRLNAENEKDSRRRQAKLQKELADAAKEPLPIEADDDIEVLT
EDAGKAGGETSPSRLLTRTPSKKISQQPPGGLLDSISLMFGRRRSANSFSTSPESSEAPS
GVCTEVRVPTTALHVFEAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVAGRCEPKGAL
TGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNAR
IVSGSYDRTLKLWDLRSKVCMKTVFAGSSCNDIVCTEQCVMSGHFDKKVRFWDIRAESIV
RELELFGRVTSLDLNHDRTELLTCSRDDLVKIVDLRTNAVKQTLSAQGFKCGADWTRVTF
SPDGSYVAGGSADGALYIWNVLTGKVDRTLDRNHSSAINSVSWSPSGAYVASVEKGSRAI
LWSDM
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcggcgaggcgagtgtttgtggaagaaacacgtggcggagcaactgaagctt
agagaccgagagcagagacaggccttcgaggagatcatcctgcagtataaccgtctcctg
gagaaggcggacctgcaggccgtcctatcagagcgttaccaggccgacaaatatgacgtc
cagagaggccacgagtccagtgcggcagactcgagtcgcagcgacgccctgcagcaggag
atggctcagatgaggattcggcaccaggaggagctgacggagctgcacaagaaacgagga
gagctggctcagagcgtgatcgaactgaacaaccagatccaacagaaggaccgagagatc
cagaacaacgaggccaagatgcttgagtaccagcagcagatctccagcctggagggcgac
tgccgcgagctcaggagctgcttgcaggacctggagagggcgaatcagacgctgaaggac
gagtatgacgccctgcagatcaccttctccgccctggaggagaagctgaggaagaccacc
gaggacaaccaggagctggtgtcccgctggatggccgagaaggctcaggaggcgaaccgg
ctgaacgccgagaacgagaaggacagcagacggcggcaggccaaactgcagaaggagctc
gccgacgctgccaaggaaccgctgcccattgaggcggacgacgacatcgaagtgctgact
gaggacgccgggaaggcaggaggggagacgtcgccgagccggctgcttaccaggactccc
agtaagaagatctcccagcagcctccaggggggctgcttgactctatctccctcatgttt
ggcaggcgtcggagcgccaactctttcagcacttcaccggagagcagcgaggccccgtca
ggcgtctgcacggaggtccgcgtgcccaccacagcgctgcacgtctttgaagcccacgac
ggcgaggtgaacgctgtgaggttcagccctggctcccgtctcctagcaacaggagggatg
gaccgcagggtgaagctgtgggaggtggtggcaggtcgctgtgagcccaaaggagctctg
accggcagcaacgcgggaatcaccagcattgagttcgacagtgctggctcctacctgctc
gccgcctccaacgacttcgccagccggatttggaccgtggatgactacagactgaggcac
acgctgacgggtcacagcgggaaagtcctctctgctcgcttcctgttggacaacgctcgc
atcgtctctggaagctacgaccgcacgctcaaactgtgggaccttcgcagcaaagtctgt
atgaagacggtgttcgcgggctccagctgcaacgacatcgtgtgcaccgagcaatgcgtc
atgagcggacattttgacaaaaaggttcgcttctgggacatcagagcggagagcatcgtg
cgggagctggagctgttcggcagagtgacgtctctggatctgaaccacgatcgcaccgag
ctgctcacctgctccagagacgacctggtgaagatcgtcgacctgcgcaccaacgccgtg
aagcagacgctcagtgcgcagggtttcaagtgtggagctgattggaccagagtgaccttc
agtcctgacgggagctacgtggccggcggatcagctgacggcgctctgtacatctggaac
gtgctgacggggaaagtggaccgaactctagaccggaaccacagctcagccatcaactcg
gtgtcctggtcgccttcgggagcatacgtggcaagcgtggagaaaggcagtcgcgccatc
ttgtggtcagacatgtga

DBGET integrated database retrieval system