KEGG   Oreochromis niloticus (Nile tilapia): 100696058
Entry
100696058         CDS       T06104                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100696058 (ahrr)
Transcription factors [BR:onl03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100696058 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4 RLL
Other DBs
NCBI-GeneID: 100696058
NCBI-ProteinID: XP_003460145
Ensembl: ENSONIG00000017966
UniProt: I3KNE4
AA seq 694 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKTSRKHIISTASSNPEPRKESLPLGTGVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGTVAHQDNQLAAGTGEDFVVSSLFHSPEAGEIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSASGAPVPPQLALFCIAVPLLLPSITEMKMKNMLMRGKN
KGAVGGIISGLEQGERGEHLRRHSFNGGMGDAEDSLRLSCPTPGATQRGHHTPWTPLSKD
NLKYRPDGYYNQEEPLNYCKSSVGPHKGLSPGVGGGWPVRQNSGPVRAGQGVGYIPSNRM
NKTGQYGKPYRLSPSCHSGRGGEVFVSKLYGNVQIPTDPDAYCVDLVKSENGYGECFDGH
LMPEMPPIKVEHDSDSENGCDAYGRPWTCRDQVPVDRRYGNGLYDHTTGLQLKSEADYYD
PQYSPCQRGKAGISPPYNNGNYQNYAVNNGNANARLLKCDKDLGSNNDSSQFSPQRFPHS
DSLCSSQSVNLMDSHVYSQDPHKAYMQSDYNKHGTYEFKGHGLIHSIKREPMDSPPWPES
GHDMNQSIMVGSRNVMPCVMSTGHHKSSPYIYMP
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgatccctcctggagactgcatgtatgcgggcagaaagaggaggaagcccatccagaaa
cagaagccatcttctgccaatgagaaaaccaacccatccaagcggcaccgggacaggctg
aatgctgaactggaccgcctggccagcctgctgccattccccccagatgtcatctctaag
ctggacaagctgtcagtgctccgtcttgctgtttcctacctccgcgtcaagagtttcttc
caagcgagccaagacaagaccagcaggaagcacatcatcagcacagcatcctctaaccct
gaacccaggaaagagagccttccactgggcacaggcgtgaatgaaagcagcctcctcctg
gaatctctgacaggctttgccttggtggtgagcagtgacgggatggttttttacgcttcc
tcgaccattgtggactatctgggatttcatcagactgacgtgatgcaccagaatgtgttt
gactacatccacatagacgaccgtcaggaattcagacgccagctccactgggccatgtgt
cctccacagcaccaagggacggtggcacaccaggataaccagctagctgcaggaactggt
gaagactttgtagtgagcagcctgttccattctccagaggcaggggaaatccctcccgag
ctctcctgctttctcaacagatgtttcatagccagagtccgatgccttttggacagcact
tctggattcttgacgatgcagttccaaggtcggttgaagttcctccatgggcagaaaaag
aagtcagcctctggtgctccagtgcccccacagctggctctgttctgcatagctgttccc
ctcctgctcccctctatcacggaaatgaaaatgaagaacatgttaatgcggggaaagaat
aaaggagcagtaggaggaatcatctccggactggagcaaggtgagcgtggagaacacctc
cggagacactccttcaatggaggaatgggtgacgctgaagattctctccggctctcctgt
cccactcctggtgcaacccagcgaggtcaccacactccctggaccccactctccaaagac
aacctcaagtaccgcccggacggttactataaccaggaggagcccctaaactactgcaag
tcctctgtgggtccccataaaggtctgagcccaggcgtgggtggcggctggcctgtgcga
cagaactcaggacccgtcagggcaggccagggcgtcggctacatcccctctaaccgcatg
aacaagaccggccagtatgggaagccgtaccgtctctcgcccagctgtcacagcggcaga
ggtggtgaggtgtttgtctccaaactgtatggcaacgtccagattcccacagacccagac
gcctactgcgtggacctggtgaagagcgagaacggctacggagaatgcttcgatggtcac
ctgatgcccgagatgccccccatcaaggtagagcacgactctgattcggagaacggctgc
gacgcgtacggccgaccctggacgtgccgcgaccaagtgcccgttgaccgtcgctatggt
aacggcctatatgaccacaccactggcctgcagcttaaatctgaagctgattattacgat
ccacagtattcgccctgtcagcgggggaaggctgggatcagcccgccgtacaacaacggt
aactatcagaactatgcagtgaacaacgggaacgccaacgcacgcctgttaaagtgcgac
aaagacctgggcagtaacaatgactccagtcagtttagtcctcagagattcccacactca
gactctctatgcagcagccaatccgtcaacctcatggactcacacgtctactcacaggat
ccacacaaggcctacatgcagtctgactacaacaagcatggcacctacgagttcaaaggt
cacggcctgatccattcgatcaagcgggagcccatggactctccgccgtggcccgagagc
ggccatgacatgaaccagtccataatggtcggctccaggaacgttatgccatgcgtgatg
agcacaggacaccacaagtccagtccatatatttacatgccgtga

DBGET integrated database retrieval system