KEGG   Odobenus rosmarus divergens (Pacific walrus): 101366544
Entry
101366544         CDS       T05148                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04071  Sphingolipid signaling pathway
oro04145  Phagosome
oro04148  Efferocytosis
oro04151  PI3K-Akt signaling pathway
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04520  Adherens junction
oro04530  Tight junction
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04810  Regulation of actin cytoskeleton
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04972  Pancreatic secretion
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05100  Bacterial invasion of epithelial cells
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05163  Human cytomegalovirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05208  Chemical carcinogenesis - reactive oxygen species
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05231  Choline metabolism in cancer
oro05415  Diabetic cardiomyopathy
oro05416  Viral myocarditis
oro05417  Lipid and atherosclerosis
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101366544
   04014 Ras signaling pathway
    101366544
   04015 Rap1 signaling pathway
    101366544
   04310 Wnt signaling pathway
    101366544
   04370 VEGF signaling pathway
    101366544
   04071 Sphingolipid signaling pathway
    101366544
   04024 cAMP signaling pathway
    101366544
   04151 PI3K-Akt signaling pathway
    101366544
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101366544
   04148 Efferocytosis
    101366544
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101366544
   04520 Adherens junction
    101366544
   04530 Tight junction
    101366544
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101366544
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101366544
   04620 Toll-like receptor signaling pathway
    101366544
   04650 Natural killer cell mediated cytotoxicity
    101366544
   04662 B cell receptor signaling pathway
    101366544
   04664 Fc epsilon RI signaling pathway
    101366544
   04666 Fc gamma R-mediated phagocytosis
    101366544
   04670 Leukocyte transendothelial migration
    101366544
   04062 Chemokine signaling pathway
    101366544
  09154 Digestive system
   04972 Pancreatic secretion
    101366544
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101366544
  09158 Development and regeneration
   04360 Axon guidance
    101366544
   04380 Osteoclast differentiation
    101366544
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101366544
   05205 Proteoglycans in cancer
    101366544
   05208 Chemical carcinogenesis - reactive oxygen species
    101366544
   05203 Viral carcinogenesis
    101366544
   05231 Choline metabolism in cancer
    101366544
  09162 Cancer: specific types
   05210 Colorectal cancer
    101366544
   05212 Pancreatic cancer
    101366544
   05211 Renal cell carcinoma
    101366544
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101366544
   05163 Human cytomegalovirus infection
    101366544
   05167 Kaposi sarcoma-associated herpesvirus infection
    101366544
   05169 Epstein-Barr virus infection
    101366544
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101366544
   05135 Yersinia infection
    101366544
   05100 Bacterial invasion of epithelial cells
    101366544
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101366544
   05020 Prion disease
    101366544
   05022 Pathways of neurodegeneration - multiple diseases
    101366544
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101366544
   05418 Fluid shear stress and atherosclerosis
    101366544
   05415 Diabetic cardiomyopathy
    101366544
   05416 Viral myocarditis
    101366544
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101366544
   04933 AGE-RAGE signaling pathway in diabetic complications
    101366544
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101366544
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101366544
   04031 GTP-binding proteins [BR:oro04031]
    101366544
Membrane trafficking [BR:oro04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101366544
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    101366544
  Macropinocytosis
   Ras GTPases
    101366544
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101366544
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101366544
  Exosomal proteins of other body fluids (saliva and urine)
   101366544
  Exosomal proteins of colorectal cancer cells
   101366544
  Exosomal proteins of bladder cancer cells
   101366544
GTP-binding proteins [BR:oro04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101366544
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 101366544
NCBI-ProteinID: XP_012415665
Position
Unknown
AA seq 145 aa
MPVSGRSQSDTPSQGFVDQLHPLSYPQTDVFLICFSLVSPASFENVRANWYPEVRHHCPN
TPIILVGTKLDLRDDKDKIKKLKEKKLTPITYPQGLAMAKEIGAVKYLECPALTHRGLKT
VFDEAILAVLCXPPIKKRKRKCLLL
NT seq 438 nt   +upstreamnt  +downstreamnt
atgccggtcagtggccgctcccagtcagacacgccatcacaaggttttgtggaccaatta
catcccttatcctatccacaaacagatgtattcttaatttgcttttctcttgtgagtcct
gcatcatttgaaaatgttcgagcaaactggtaccccgaagtgcgacaccactgtcccaac
acccccatcatcttggtggggaccaaacttgatctcagggatgacaaagacaagatcaag
aagctgaaggaaaagaagctgactcctatcacctacccacagggtctggccatggctaag
gagattggtgcagtaaaatacctagagtgcccggcactcactcatcgaggcctcaagaca
gtgtttgatgaagcgattctagcggttctctgcncccctcccatcaagaagaggaagaga
aaatgcctgctgttgtaa

DBGET integrated database retrieval system