KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331944
Entry
4331944           CDS       T01015                                 
Name
(RefSeq) dehydrodolichyl diphosphate syntase complex subunit NUS1 isoform X1
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4331944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4331944
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     4331944
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4331944
SSDB
Other DBs
NCBI-GeneID: 4331944
NCBI-ProteinID: XP_015631063
Position
3:complement(5085605..5090352)
AA seq 291 aa
MYDIHFVLSQEIIILWFLCRAAFVANEIPLFMNQSPPHVWMLMSRPSVIIKLILGLLWFI
VHLAISLCSLWFDLIYSIECYLISFGLIPKYRKFQLDRLKHLAVVVDSREAKNVAKINQL
LCWLSNVGVKYVCLYDIDGVLKKTFAPAMNGSRYGNSGKYLDVGANTKALTCCHKEMTIE
CISGSDGKDGIAKAASLLCSTCVNGNRNTCGNGEIVFTEADMSGALKAIGCGGPEPDLLL
VYGPARCHLGFPAWRLRYTEIMHMGPLNSMKYGAIVKAFYKFSKKYQNFGK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtatgatatccactttgtcctttctcaagaaataattatcttgtggttcttgtgcagg
gcggcatttgtggccaatgagattcccctattcatgaatcagtctcctccacatgtatgg
atgctgatgtctcgaccatcagtgattatcaagctgattctggggttgctttggttcatc
gtccacttagcaatcagcctttgcagtttatggtttgatctgatctacagtatagaatgc
tatctcatttcattcgggctgattccaaagtatcggaaattccaactggataggctcaaa
cacttggctgttgtggtagatagcagagaagctaaaaatgttgcaaagatcaatcagctc
ttatgttggctctcaaatgttggtgtgaagtatgtatgtctttatgacattgatggagtg
ctgaagaaaacatttgcacctgctatgaatggttcaagatatgggaattcaggaaaatat
ctggatgtgggtgcaaatacaaaagctttgacctgttgtcataaagagatgacaatagag
tgtatttctggttctgatggcaaggatgggattgctaaagcagccagcttactttgctca
acttgtgtgaacggcaataggaatacttgtggaaatggtgaaatagtatttacagaagct
gacatgtccggtgcattgaaagcaataggttgtggtggaccagaacctgatcttcttctt
gtgtatggccctgctagatgccatttaggttttcctgcatggagattgcggtatactgag
ataatgcatatgggaccactgaattcaatgaaatatggcgccattgtgaaagcattctat
aaattctcgaagaaataccaaaattttggtaaatga

DBGET integrated database retrieval system