KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342783
Entry
4342783           CDS       T01015                                 

Definition
(RefSeq) putative inactive cadmium/zinc-transporting ATPase HMA3
  KO
K01534  Zn2+/Cd2+-exporting ATPase [EC:7.2.2.12 7.2.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4342783
Enzymes [BR:osa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     4342783
    7.2.2.21  Cd2+-exporting ATPase
     4342783
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 DUF6353
Other DBs
NCBI-GeneID: 4342783
NCBI-ProteinID: XP_015647368
UniProt: Q8H384
Position
7
AA seq 1004 aa
MAGKDEAEGLEARLLLLPPEAAAEEPTRCGGGDGGGGGRKRKKTYLDVLGVCCSAEVALV
ERLLAPLDGVRVVSVVVASRTVVVEHDPAAAPESAIVKALNKAGLEASVRAYGSSGVVSR
WPSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPMVRRGFAAASRLSLDINVLML
IAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASAGMSSLMGMLPVKAVIATTGEVV
SVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLTGESFPVPKQPHSEVWAGTMNFD
GYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLIDSCAKYYTPAVVVVAAGVALIPA
LLGADGLEQWWKLALVMLVSACPCALVLSTPVASFCAMLRAARMGIFIKGGDVLESLGEI
RAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWIASIESKSSHPMAAALVEYAQSK
SIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRTLARASSPQSTQEMGEMIKGVSIGY
VICDGELAGVFSLSDDCRTGAAEAIRELGSLGIKSVMLTGDSSAAATHAQGQLGGVMEEL
HSELLPEDKVRLVSGLKARFGPTMMVGDGMNDAAALAAADVGVSMGISGSAAAMETSHAT
LMSSDVLRVPEAVRLGRCARRTIAVNVAGSVAVKAAVLALAAAWRPVLWAAVLADVGTCL
LVVLNSMTLLREEWKGGAKEDGACRATARSLVMRSQLAADSQAPNAADAGAAGREQTNGC
RCCPKPGMSPEHSVVIDIRADGERQEERPAEAAVVAKCCGGGGGEGIRCGASKKPTATVV
VAKCCGGGGGGEGTRCGASKNPATAAVVAKCCSGGGGEGIGCGASKKPTATAVVAKCCGG
GGEGTRCAASKKPATAAVVAKCCGGDGGEGTGCGASKRSPPAEGSCSGGEGGTNGVGRCC
TSVKRPTCCDMGAAEVSDSSPETAKDCRNGRCCAKTMNSGEVKG
NT seq 3015 nt   +upstreamnt  +downstreamnt
atggccggaaaggatgaggcggaagggctcgaggcgaggctgctgctgctgccgcctgag
gcggcggcggaggagccgacgaggtgtggcggcggcgacggcggcggcggcgggaggaag
cggaagaagacgtaccttgatgtccttggcgtgtgctgctccgcggaggtcgcgctggtg
gagcggctgctcgcgccgctcgacggcgtccgcgtggtgtccgtcgtcgtggcgtcccgc
accgtcgtcgtcgagcacgaccccgccgccgccccggagtccgccatcgtgaaggcgctg
aacaaggccggcctcgaggcgtcggtgcgagcctacggcagcagcggcgtggtcagccgg
tggccgagcccgtacatcgtcgcctccggcgtcctcctcacggcgtccttcttcgagtgg
ctcttccctcccctgcagtgcctggccgtggcggccgtcgtcgccggcgcgccgccgatg
gtgcgccgtgggttcgccgcggcgagccggctgtcgctcgacatcaacgtcctcatgctc
atcgccgtcgccggcgcgctctgcctcggcgactacacggaggccggcgccatcgtcttc
ctcttcaccaccgcagaatggctcgagacgctggcctgcacaaaggcgagcgccgggatg
tcgtcgttgatgggcatgctgccggtgaaggcggtcatcgcgacgacgggcgaggttgtc
agcgtgcgcgacgtccgcgtgggcgacgtcgtcgcggtcagggccggcgagatcgtcccc
gtcgacggcgtggtggtcgacggccagagcgaggtcgacgagaggagcctcaccggcgag
tccttcccggtgccgaagcagccgcactccgaggtctgggccggcacaatgaactttgac
ggttacattgctgtgagaactacggctctcgccgagaactcgacggtggcgaagatggag
aggctggtggaggcggcgcagaacagcaggtcgaagacgcagcggctgatcgattcgtgc
gcaaagtactacacgccggccgtggtggttgttgcagcaggagtggccctgatcccggct
ctgctcggagcagatggccttgagcaatggtggaagctggctctggtgatgcttgtgagc
gcgtgcccctgcgcattagtgctgtcgacaccggtggcatccttctgcgcaatgctgcgc
gctgcgaggatggggatcttcatcaagggtggagatgttcttgaatcacttggggagatc
agggccgtcgcgttcgacaagaccgggacgatcaccagaggagagttcagcatcgactcg
ttccatctggttggggatcacaaggttgagatggatcatcttctttactggattgcaagc
attgagagcaagtcaagccacccaatggcagctgcacttgtggagtatgctcaatccaaa
tccatccaaccaaacccggaaaatgtgggcgattttcggatatatcccggggaggggatc
tatggagagatccatggaaagcacatctacattgggaacagaaggacattggcaagagcg
tcatcacctcagtcaactcaagaaatgggtgagatgatcaagggcgtgtcgatcggctac
gtgatctgcgacggcgagctcgccggcgtcttctcgctctccgacgactgccggaccggc
gcggcggaggcgatccgggagcttggatcgctgggcatcaagtcggttatgctgaccggg
gacagcagcgcggcggcgacgcacgcgcagggccagctcggcggcgtcatggaggagctc
cactccgagctcctcccggaggacaaggtccggctcgtcagcggcctcaaggcgaggttc
ggcccgacgatgatggtcggggacgggatgaacgacgcggcggcgctggcggcggcggac
gtgggcgtgtccatgggcatctccgggtcggcggcggcgatggagaccagccacgcgacg
ctcatgtcgagcgacgtgctcagggtccccgaggccgtcaggctcggccggtgcgcccgc
cggaccatcgccgtcaacgtggccggctcggtggccgtgaaggccgccgtgctcgcgctg
gccgcggcgtggcgccccgtgctctgggccgccgtgctcgccgacgtcgggacgtgcctc
ctcgtcgtgctcaacagcatgacgctgctcagggaggagtggaagggcggcgccaaggag
gacggcgcgtgccgcgccacggcgaggtcgctggtgatgaggtcccagctcgccgccgac
tcccaagcacccaacgccgcagacgctggcgccgccggccgtgagcaaacgaacggctgc
cgttgctgtccgaagccgggcatgtcgcccgagcactcggttgtcatcgacatccgagcc
gacggcgagcgtcaagaagagcggccggccgaggcggccgtcgttgccaaatgttgcggc
ggaggcggcggcgagggcatccgctgcggagcctccaagaagccaactgcaacggtcgtt
gttgccaaatgttgcgggggcggcggcggcggcgagggcaccaggtgcggcgcgtccaag
aatccggcaacggcggccgtcgttgccaaatgttgcagcggaggcggcggcgagggcatc
ggctgcggagcctccaagaagccaactgcaacggccgttgttgccaaatgttgcggcggc
ggcggcgagggcaccaggtgcgccgcgtccaagaagccggcaacggcggccgtcgttgcc
aaatgttgcggtggcgatggcggcgagggcaccggatgtggtgcctccaagaggtcgccg
ccggctgagggaagctgcagcggcggtgaaggcggtaccaatggtgttggtcgttgctgc
acgagcgtgaagaggccaacctgttgcgacatgggagcggcggaggtgtccgattcttcg
ccggagacggcgaaagactgcagaaatgggaggtgttgcgcgaagacgatgaactccggt
gaagtgaaaggatga

DBGET integrated database retrieval system