KEGG   Orientia tsutsugamushi Ikeda: OTT_0550
Entry
OTT_0550          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraA
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: AAA_30 AAA_19 RIX1 Viral_helicase1
Other DBs
NCBI-ProteinID: BAG40008
UniProt: B3CQS8
Position
complement(568215..568925)
AA seq 236 aa
MQGSLIVVDEAGMVGTKAYAELFRVVRNNNCQLILAGDEKQLASIERGGMFEMLSNIFGS
HVLVNIRRQSKNWSREAATKFAESNILSCITLLRQNKCVRFDNTLQDSMSKLIYNWSLSK
FKPHEKLVITVRNKDVDILNSSIRSLLKANGTLKGTEYERSIDGRKKSYMAGDRIVFQKS
YKDLQIQNSEFATLTSVSKNKFIAKTDTGKEVSFDSVKYNLNMAMQVLFIRSRELL
NT seq 711 nt   +upstreamnt  +downstreamnt
atgcaaggcagcttaatagtagtagatgaagctggaatggtaggtactaaagcttatgca
gagctgtttagagtagttagaaacaataattgtcaactgatacttgctggagatgaaaag
cagttagcttcaatagaaagaggtggaatgtttgagatgctgagtaatatttttggttca
catgttttagtaaatattcgaagacaaagtaaaaactggagcagagaagcagcaacaaag
tttgctgagagtaatattttaagctgtataaccttactgaggcaaaataaatgcgttagg
tttgataatacgttgcaggactcaatgagtaaattaatatacaactggagtctaagcaaa
tttaaaccacatgaaaaattggtaattacagtacgtaataaagatgtcgacattcttaat
tcaagtattaggtctttgttaaaagcaaatggtacgctaaaaggcacagaatatgagcgt
tctattgatggaaggaaaaagtcatatatggcaggagatagaatcgtatttcaaaaaagc
tataaggatttacaaatacaaaacagtgaatttgcaactttaacttcggttagtaaaaat
aaatttatagctaagacagacacaggaaaagaagtgagttttgattcggtaaaatacaat
ttaaacatggctatgcaagtactgtttataaggtccagggagcttctataa

DBGET integrated database retrieval system