KEGG   Pseudomonas aeruginosa PAO1: PA0259
Entry
PA0259            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DUF2875 Csa1
Other DBs
NCBI-GeneID: 881892
NCBI-ProteinID: NP_248950
UniProt: Q9I6N0
Position
complement(289562..291004)
AA seq 480 aa
MSADAYHPPTTSPRLETLDVLSIGMSLDVFRQGQVWKALQEQNAAQAEALHVGSILPMDP
KKYPTSADDKDMAYEKRQADALELGLKNFLEKWPIPTVTVVRGWDPSTPNLRFTPEETRE
SLSVKVNDLRVPAGLHWHRIANLQDGIICNDTPEGVLEALFSLFERNPDLPAVLVYANEG
ISMAGALSSRDVTLKSLGAVSGPRIPGTLTDAMVALIVGRPERVDWLRQFAPYTKVNENR
IDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPVLARLHRPVSVPLTHPDTGER
LKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLAELTPALGAAQSSLDLLDSRE
SYDLTQRLGDTGAASPFVGITLATMASYLNGDSSMVMPLRRKDQATLIGISSPTPGKKPV
HDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPGEDYALEEFLSSLKPSTDWQDDL
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtccgctgatgcttatcacccaccgacaacttcgccgcgcctggaaaccctggacgtg
ctcagcataggcatgagcctggatgtgtttcgccaggggcaagtgtggaaggccttgcag
gagcagaatgccgcacaggccgaggcgttgcatgtcggcagcatcctgccgatggacccg
aagaagtatccgacgtctgcggatgacaaggatatggcgtatgaaaagcgccaagcggac
gccttggaactagggctgaaaaacttcctggagaaatggccgataccgacggtgacggtg
gtgcgtggttgggatccgagcactcctaacctacgcttcactccggaggagacgcgggaa
agcctgtcagtaaaagtcaatgatctccgtgttccggctggactgcattggcatcggatt
gccaatttgcaggatggcattatctgtaacgatacgcctgaaggagtactggaggcgttg
ttcagtttattcgaacgcaaccctgacttgccagcagtgttggtgtatgcgaatgaaggc
atcagtatggcgggggcgctttccagtagagatgtaacattgaagtcactaggcgctgtg
tcaggccctcggatacctggaacgcttacggatgcaatggtcgccctgatcgtcggccgc
cccgagcgggtcgactggctacgccagttcgccccctacaccaaggtcaacgaaaaccgg
atcgaccccgagttccgtggctggggctggcgcaagccgccggtggagttccgccccacg
ccgttcattccccagccctggaccgagcgggctctggagcagtgggatgcgttgccggtg
ctggccaggctgcatcggccggtgagtgtgccgctgacccacccggataccggcgaacgg
ctcaagcgcgaagctctcaccgcacaactggccgctgcctggaagacggccagtgccggg
ctcaggccggcgcccgcccggctgttctacgacggcggtttgaacgccacgccgctggcc
gaactcaccccggcgctgggcgccgcgcagagttcgctggacttgctggactcgcgggaa
agctacgacctgacccagcgcctgggcgacaccggcgcggcctcgcccttcgttggcatc
accctggcgaccatggccagctacctcaacggcgacagcagcatggtgatgccgttgcgg
cgcaaggaccaggcgaccctgatcggcatcagctcgccgacgccggggaagaagcccgtt
cacgacccgttcggcgtcgacctgctgccgcagaccgccagcggcgacggtccgccgcca
tcggccgacccggtggcgcccgccagtcggctcacgacccggttgccgcccggcgaagac
tatgccctggaagagttcctgagcagcctcaaacccagcaccgactggcaggacgattta
tag

DBGET integrated database retrieval system