KEGG   Pseudomonas aeruginosa PAO1: PA2113
Entry
PA2113            CDS       T00035                                 

Symbol
opdO
Name
(RefSeq) pyroglutatmate porin OpdO
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: OprD Porin_4
Other DBs
NCBI-GeneID: 879972
NCBI-ProteinID: NP_250803
UniProt: Q9I202
Structure
PDB: 
3SZV 2Y0K

Position
complement(2323554..2324783)
AA seq 409 aa
MHPTPRLAAALLAGSGLGWPLLAQADLVEDSHASLELRNFYFNRDFRQSGARDNADEWAQ
GFLLRLESGFSEGTVGFGVDAIGLLGFKLDSGSGSGGTGLLPADGSAGGSQDDYAKLGLT
AKARVSNSLLKVGALHFKSPLVSANDTRLLPELFRGALLDVQEIDGLTLRGAHLDRNKLN
SSSDYQVFSANRIGGRSDAFDFAGGDYRLTPALTASLHQGRLKDIYRQTFAGLVHTLDLG
GQRSLKSDLRFARASEDGGFRELDNRAFGALFSLRLGAHAVAAGYQRISGDDPYPYIAGS
DPYLVNFIQIGDFGNVDERSWQLRYDYDFGALGLPGLSFMSRYVSGDNVARGAANDGKEW
ERNTDLGYVVQSGPLKNLGVKWRNATVRSNFANDLDENRLILSYSLALW
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcatcccactccccgcctggctgccgcgctgctcgccggcagcgggctgggctggccg
ctgctcgcccaggccgacctggtcgaggacagccacgccagcctcgaactgcgcaacttc
tacttcaatcgcgacttccgccagagcggcgcgcgcgacaacgccgacgaatgggcgcag
ggcttcctcctgcgcctggagtccggcttcagcgaaggcaccgtcggcttcggcgtcgac
gccatcggcctgctcggcttcaagctcgactccggcagcggcagcggaggaaccgggctg
ctgccggccgacggctccgccggcggctcccaggatgactacgccaagctcggcctgacc
gccaaggcgcgggtctccaacagcctgctcaaggtcggcgcgctgcacttcaagagcccg
ctggtctcggccaacgacacccgcctgctgccggaactgttccgtggcgcgctgctcgac
gtgcaggagatcgacggcctgaccctgcgcggcgcgcacctggaccgcaacaagctgaac
agctccagcgactaccaggtgttcagcgccaaccgcatcggcgggcgcagcgatgccttc
gacttcgccggcggcgactatcgcctgaccccggcgctgaccgccagcctgcaccagggt
cggctcaaggacatctaccgacagaccttcgccggcctggtacacaccctcgacctcggc
ggacagcgttcgctcaagagcgacctgcgcttcgcccgggccagcgaggacggcggcttc
cgcgaactggacaaccgcgccttcggcgccctcttcagcctgcgcctgggcgcccacgcg
gtggccgccggctaccagcggatcagtggcgacgatccctatccctacatcgccggcagc
gacccgtacctggtcaacttcatccagatcggcgacttcggcaacgtcgacgagcgttcc
tggcaactgcgctacgactacgatttcggcgcgctcggcctgcccggcctgagcttcatg
agccgctacgtctccggcgacaacgtcgcccgcggcgcggccaacgacggcaaggaatgg
gaacgcaacaccgacctcggctacgtggtgcagagcgggccgctgaagaacctcggggtg
aaatggcgcaacgccacggtgcgttcgaatttcgccaacgacctcgacgaaaatcgcctg
atcctcagctacagcctggcgctgtggtga

DBGET integrated database retrieval system