KEGG   Pseudomonas aeruginosa LESB58: PLES_26541
Entry
PLES_26541        CDS       T00818                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Motif
Pfam: UPF0242 Macoilin DUF2353 Pex19 Golgin_A5 Mod_r YabA DUF4407
Other DBs
NCBI-ProteinID: CAW27379
Position
complement(2852621..2854039)
AA seq 472 aa
MRSNGLLKWLMIPVAILVLFVGIRLFSGGGSTAPPAADNGAQLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQE
QAASARQQTEGLLADLQRRLDSIGGRGGGHADLPVGLGLQGGDEAGMEGGVRWVEPDDAK
PAEGRNGGRGASGGMSFPTSFGPAQSTLETTAETVANAGARASGVKSAKPVYTVPTNSTL
MGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLS
CVRGQVRSITFVFNDGTIRTIPEDREGNQQNNQQRDGLGWISDPHGIPCVSGERRSNAQQ
YLGSQALITAAGAGVASLIESDSGRMSYVGSDGSIGTVGITGQEAVGQILAGGVRDMSAW
VNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELD
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggcctgctcaagtggctgatgatccctgtcgccatcctggtgctgttc
gtcggtatccggctgttctcgggtggaggcagcacggcgccacccgcggcggacaacggc
gcccagctcacgcccgaggaaatgaaggcgctgggcatcgaaggcgacaccccgcgcgac
accgtggcgacgctcgttgcccaagtgaagcagttgcgcaccgagcttcagaccgcgctc
tcggacaacaagtcgcagcgtgaagagaaccagcgactgcgccagcgcgagaactccatc
gaccagcgcatcaactcggcgctcgaatccgagcggtccaacctgcgccgcgaccaggag
caggcggccagcgcgcgccagcagaccgaagggctgctcgccgacctgcagcggcgcctg
gacagcatcggcgggcgcggcggcggccatgcggacctgcccgtgggcctggggctgcag
ggcggcgacgaggccggcatggagggcggcgtgcggtgggtcgagccggacgacgcaaag
cccgccgaggggcgcaacggcggtcgtggcgcgagcggcggaatgagcttccccacgagc
ttcggcccggcgcagagcacgctcgaaaccaccgcggaaaccgtggccaacgcgggcgcc
cgcgcctctggggtcaagagtgccaagccggtctataccgtgccgaccaactccacgctc
atgggttcggtcgccatgaccgcgctgatcggccgcgtgccgatcgacggcacggtcaac
gatccctatccgttcaaagtcctggtcgggccggacaacctgaccgccaatggcatcgac
attcccgacgtggccggcgccgtgttcagcggcaccgcatcgggcgactggacgctttcg
tgcgtgcgcggccaggtgcgcagcatcacgttcgtcttcaacgacggcacgatccgcacg
atccccgaagaccgcgagggcaaccagcagaacaaccagcaacgcgacggcttgggctgg
atcagcgacccgcacggcatcccctgcgtcagcggcgagcggcgcagcaacgcccagcag
tacctcggctcgcaggccctgatcaccgcggccggtgccggcgtggcctcgctcatcgag
agcgacagcggccgcatgtcctatgtcggctcggacggctccatcggcaccgtgggcatc
accggccaggaagcggtcggccagattctcgcgggcggtgtccgggacatgtcggcctgg
gtcaacaagctctacggccaggcgttcgccgccgtctatgtgcagcccggcgccaaggtc
gccgtccacctcgaaaaaccgctcgccatcgacttcgatcccgaaggccgcaaggtcgat
caccgcgcaggagaaagccatgctctcgaactcgattaa

DBGET integrated database retrieval system