KEGG   Pseudomonas aeruginosa LESB58: PLES_36641Help
Entry
PLES_36641        CDS       T00818                                 

Definition
(GenBank) probable transcriptional regulator
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
KEGG Orthology (KO) [BR:pag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pag03000]
    PLES_36641
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_36641
Transcription factors [BR:pag03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    PLES_36641
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PLES_36641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 GAF_2 HTH_30 AAA_16 HTH_50 HTH_1 AAA_2 AAA AAA_7 TIP49
Motif
Other DBs
NCBI-ProteinID: CAW28391
Position
complement(4053281..4054792)
Genome map
AA seq 503 aa AA seqDB search
MFSRVPQPLAFAEALLAQFGALSRETDAAALLGGFARAVGELSGCELSQLYLLDQTHTAL
TLNAECRDGLLQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAGEQP
WLSLLCVPLVSPEKTVEGMVVCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGE
PQGPSSAPVVSGYGLIGRSAAMRETCRLISKVLHNPYTVLLQGETGTGKEVVARAIHEYG
PRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRPGLFDAADGGTLLLDEIGDMP
LSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFREDLYYRLAQFP
IELPPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGEMLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAAREL
GLPRRTLIYRMGRLNIHFGDPRT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgttcagccgcgtaccgcaacccctggccttcgccgaagccctgctcgctcagttcggc
gcgctgtcgcgggaaaccgacgccgcggccctgctgggcggtttcgcacgcgcagtcggc
gaactcagcggctgcgagctgagccagttgtatctgctcgaccagacccataccgcgctc
accctcaacgccgaatgccgggacggcctgttgcaggcgctggagccgtcgagcctgccg
gcggactacaccggcgagcagttgctgcagttcgccctgtgccagaaccgcgtggtcagt
ctcgtcgacctgccgtcgcggctgcacgagaccggcttcctgccggcaggggagcagccc
tggctgtccctgctctgcgttccgctggtgagcccggagaaaacggtcgagggcatggtg
gtctgcgctacccggcgcccactggacctgcagggattcgcccatccactgggccagctg
ggctcgttcgtgctggcccagctgcatctgctgcaacgcctctcgcaaccctccggcgag
ccgcagggaccgtccagcgcaccggtggtcagcggctacgggctgatcggcaggagcgcg
gcgatgcgtgagacctgccgcctgatcagcaaggtcctgcacaacccctataccgtgttg
ctgcagggcgagaccggcaccggcaaggaggtggtcgcacgggcgatccacgagtacggc
ccgcggcgtgcacaggcgttcgtggtgcagaactgcgcggcgtttccggaaaacctgctg
gaaagcgagctgttcggctaccgcaagggcgcctttaccggtgccgagcgcgatcgtccc
gggttgttcgatgccgcggatggcggaaccctgctgctcgacgaaattggcgacatgccc
ctctcgctccaggccaagctgttgcgcgtgttgcaggaaggcgagattcgcccgctcggc
ggcaacgacacgcacaaggtcgatgtacgcatcatcgccgctacccaccgtgacctcgcc
ctgctggtacgcgatggcaagttccgcgaagacctctactaccggctggcgcagtttccc
atcgagttgccgccgttgcgccagcgcgagggcgacgccctcgaactggcccggcatttc
gccgagcgcgcctgcgtgttcctgcgccgcgcgccgctgggctggtccgcggaagcgctg
gaactgctcgacggctatggctttcccggcaacgttcgggagctgaagggactggtggaa
tgcgcggtactgctctgcgaaggcgagatgctgctggccgaacacttttccctgcgcgcg
cccccggaagcggaggcgccgctcaagctgcgcgagcatctggagcagatcgaacgggac
ctgctgctcgcctgcctgcgcaggaacgctggcaaccagaccctcgccgcgcgcgaactg
ggtctgccgcgacgaaccctgatctatcgcatgggacgcctgaacattcatttcggcgat
ccccggacctga

DBGET integrated database retrieval system