KEGG   Pseudomonas aeruginosa PA7: PSPA7_0162
Entry
PSPA7_0162        CDS       T00569                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02025  Biofilm formation - Pseudomonas aeruginosa
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_0162
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPA7_0162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0162
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_0162
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_22 TniB AAA_25 AAA_7 Zeta_toxin ATPase_2 Clp_N NACHT AAA_18 Torsin CbiA Hpr_kinase_C SRP54
Other DBs
NCBI-ProteinID: ABR86797
UniProt: A6UXM3
Structure
PDB: 
4UQW

Position
177832..180540
AA seq 902 aa
MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQILQLPDSDLHQIVRQS
GIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVIG
ILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPENGLSASDGFNAGAAPGEASGA
MAPSAMGRQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLVDILMRRRQNNPILTGEAG
VGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGASMKGEFEQRLRQVIEDVQSS
EKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEYKKHIEKDPAL
TRRFQVVQVDEPSEHKAILMMRGVASTMEQHHQVQILDEALEAAVRLSHRYIPARQLPDK
SVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELAIIRRESAIGVATGERQRNAETL
LAEERERLAGLERRWAEEKRLVDELLETRARLRAAAEAVDAGGTPLGEGEARLDEEQRQA
LHARLAELQAQLSALQGEEPLILPTVDYQAVASVVADWTGIPVGRMARNEIETVLNLDSH
LKKRIIGQDHALEMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGG
EQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPD
VHEIFFQVFDKGVMEDGEGRLIDFKNTLILLTTNAGTEMIASLCADPELMPEPEAIAKSL
REPLLKIFPPALLGRLVTIPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVD
LIVSRCTETESGGRMIDAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFAT
AD
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgagtgagatcagtcgcgttgcgctgttcggcaagctgaacagcctggcctacaaggcc
atcgaggccgccacggtattctgcaagctgcgcggcaatccctatgtcgagctggtgcac
tggttccaccagatcctccagttgccggactcggacctgcaccagatcgtccgccagtcc
gggatcgacccggcgcgcctggccaaggacctgaccgaggccctcgaccgcctgccgcgc
ggctcgacctcgatcaccgacctgtcctcccatgtcgaggaggcggtggagcgcggctgg
gtctacggcagcctgatgttcggcgagagccaggtgcgcaccggctacctggtgatcggc
atcctcaagacgccgagcctgcgccatgccctcaccgggctgtcggcggaattcgccaag
ctcaaggtcgaggcgctcaccgagcgcttcgacgagtacgtcggcgcctcgccggagaac
ggcctgtcggccagcgacggcttcaacgccggcgccgccccgggcgaggccagcggcgcc
atggcgccgagcgcgatgggcaggcaggaggcgctcaagcgcttcaccgtggacctcacc
gagcaggcccgcagcggcaagctcgatcccatcgtcgggcgtgacgaggagatccgccaa
ctggtggacatcctcatgcgccgccggcagaacaacccgatcctcaccggcgaggccggc
gtcggcaagaccgcggtggtggaaggcttcgccctgcgcatcgtcgccggcgacgtcccg
ccggcgctgaaggacgtcgaactgcgcgccctcgacgtcggcctgctgcaggccggggcg
agcatgaagggcgagttcgagcagcgcctgcgccaggtgatcgaggacgtgcagagttcc
gagaagccgatcatcctgttcatcgacgaagcccacaccctggtcggcgccggtggcgcg
gccggcaccggcgacgccgccaacctgctcaagccggcgctggcgcgcggcaccctgcgc
accgtggcggcgaccacctgggccgagtacaagaagcacatcgagaaagacccggcgctg
acccggcgcttccaggtggtgcaggtggacgagccgtccgagcacaaggcgatcctgatg
atgcgcggcgtcgcctcgaccatggagcagcaccaccaggtgcagatcctcgacgaggcg
ctggaggcggcggtccggctgtcgcaccgctacatcccggcgcgccagctgccggacaag
tcggtgagcctgctggataccgcctgcgcgcgcaccgccatcagcctgcacgcggtgccg
gccgaggtcgacgacagccgccggcgcatcgaggcgctggaaaccgaactggcgatcatc
cgccgcgagagcgccatcggcgtcgccaccggcgaacgccagcgcaacgccgagaccctg
ctggccgaggagcgcgagcgcctggccggcctggagcggcgctgggccgaggaaaaacgc
ctggtcgacgaactgctggagacccgtgcccgcctgcgcgccgccgccgaggcggtggac
gccggcggcacgccgctgggcgagggcgaggcgcgtctcgacgaggagcagcgccaggcg
ctgcatgcgcggctggcggaactgcaggcgcaactgagcgcgttgcagggcgaggaaccg
ctgatcctgccgaccgtggactaccaggcagtggcctcggtggtcgccgactggaccggg
attccggtcgggcgcatggcgcgcaacgagatcgagaccgtgctcaatctcgacagccac
ctgaagaaacgcatcatcggccaggaccacgcgctggagatgatcgccaagcgcatccag
acctcccgcgccggcctcgacaacccgagcaagccgatcggcgtgttcatgctcgccggc
acctccggggtgggcaagaccgagaccgcgctggcgctggccgaggccatgtacggcggc
gagcagaacgtcatcaccatcaacatgagcgagttccaggaagcccacaccgtctccacc
ctcaagggcgccccgcccggctacatcggctacggcgaaggcggcgtgctgaccgaggcg
gtgcgccgcaagccctacagcgtggtgctgctggacgaagtggagaaggcccacccggac
gtccacgagatcttcttccaggtcttcgacaagggcgtgatggaggacggcgaaggccgg
ctgatcgacttcaagaacaccctgatcctgctcaccaccaacgccggcaccgagatgatc
gccagcctctgcgccgatccggaactgatgcccgagccggaagccatcgccaagtcgctg
cgcgagccgctgctgaaaatcttcccgccggcgctgctcggccgcctggtgaccatcccc
tactacccgctcagcgacgacatgctcaaggccatctcgcgcctgcaactggggcggatc
aagaagcgcgtggaggcgacccacaaggtgccgttcgagttcgacgagggcgtcgtcgac
ctgatcgtctcgcgctgcaccgagaccgagagcggcgggcggatgatcgacgctatcctc
accaacacgctgctgccggacatgagccgcgagttcctcacccgcatgctcgaaggcaag
ccgttggccggggtgcgcatcagcagccgcgacaaccagttccactacgacttcgccacg
gccgactga

DBGET integrated database retrieval system