KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_59690
Entry
PA14_59690        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ABJ13880
UniProt: A0A0H2ZGZ9
Position
5310109..5312343
AA seq 744 aa
MAGQYPLEALLRPAVELYTTTVCFTAAALCIVAPWTFSLTPLFGIVAALCFAWLGIVRLK
QAGVVLRYRRNIRRLPKYTMTSAEMPVSNEHLFIGKGFRWTQKHTQRLADTYLPQFASYV
EPSPLYERARRLEKQLEFAPFPLKLVAKATAWDVAWNPARPLPPVGGLPRLHGIEPREQD
VGLQLGERVGHTLVLGTTRVGKTRLAELFITQDIRRTHCRVRRRRVKMGRRTQTVHHGYR
RRRAEEQPDYEVVIVFDPKGDADLLKRMYVECERAGRLDEFYVFHLGHPDLSARYNAVGR
FGRISEVATRVAGQLSGEGNSAAFREFAWRFVNIIARALHALGIRPDYQQILRHVVNIDA
LFVEYAQKYISEHDPRAWDTIIQIEGKLNDKNIPFNMKGRPLRVVAIDQYLTQKRIADPV
MEGLKSAVRYDKTYFDKIVASLLPLLEKLTTGRISELLSPNYADLNDPRPIFDWMQVIRK
RAVVYVGLDALSDTEVAAAVGNSMFSDLVSVAGHIYKHGVDDGLPGSLASGKVRINLHAD
EFNELIGDEFIPMVNKAGGAGVQVTAYTQTMSDIEAKIGSRAKAGQIIGNFNNLFMLRVR
ETATAELLTNQLPKVQIYTSTPASGANDAINNNKKVAFTSSSHDQVQMTSVPMLEPAHII
GLPKGQAFALLEGGNLWKIRMPLPAVAPDEVMPKSLQELAAGMRKGQAANSEWWEAPGYS
ALQDGLPQDLVDDFRHLGTGEDAA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggctggccagtacccgttggaagcgctcttgcggcctgccgtggagctctacaccacc
accgtgtgcttcaccgcagccgcgctctgcatcgtcgcgccgtggacgttctccctcact
ccgctgttcggcatcgtggccgcgctgtgcttcgcctggctgggtatcgtgcggctgaag
caggccggcgtggtgctccgctaccggcggaacattcgccgactgccgaagtacacgatg
accagcgccgagatgccggtcagcaacgaacacctgttcatcggtaaaggatttcgctgg
acgcagaagcatacgcagcgcctggcagatacctacctgccccagttcgcctcttacgtc
gagccctcgcccctctacgagcgcgcgcgccggttggagaagcagctcgagttcgccccc
ttccccctgaagctggtcgccaaagccactgcctgggacgtggcctggaaccccgcacgg
ccgctgccgcccgtgggcggtttgcctcggctccatggcatcgagccgcgcgaacaggac
gtaggcctgcaactgggcgagcgcgtcggccacacactggtactcggcaccacgcgggtg
ggtaagacgcgcctcgcggagctgttcatcacccaggatattcgccgcactcactgccgg
gtacgacgccggcgggtgaagatgggccggcggacccagacggttcaccacggctatcgg
cgccggcgcgcagaggagcagccggactacgaggtggtgatcgtcttcgacccgaaaggc
gacgctgacctgctgaagcgtatgtacgtggaatgcgaacgtgccggccgcctggacgag
ttctacgtgttccacctcggtcatcctgacctgtcggcacgctacaacgccgtcggccgg
ttcggtcggatctccgaggtcgccacccgcgtcgccggccagctctccggcgagggcaac
agcgcggcgttccgcgagttcgcctggcggttcgtcaacatcatcgcccgcgcgctgcac
gcgctgggtatccggcctgactaccagcagatcctccggcacgtcgtgaacatcgatgcg
ttgttcgtcgaatatgcgcagaaatacatcagcgagcacgatcccagggcctgggacacc
atcatccagatcgagggcaagctcaacgacaagaacatcccgttcaacatgaaaggacgg
cccctgcgggtcgtagccatcgaccagtacctgacacagaaacgcatcgccgacccggtc
atggaaggcttgaagagcgccgtgcgctacgacaagacctacttcgacaagatcgtggcc
tcgctgctgccgctactggagaaactcactaccgggcggatctcggagcttctttcgccc
aactacgcggacctcaacgatccgcggccgatcttcgactggatgcaggtcatccgcaaa
cgcgccgtggtctacgtcggcctcgacgcactatcggataccgaggtcgccgccgcggtg
ggcaactccatgttcagcgacctggtctcggtagcgggtcacatctacaagcatggtgtc
gatgacggcctgcccggctcgctcgccagcggcaaggtccgcatcaacctgcatgccgac
gagttcaacgagctgattggcgacgagttcatccccatggtcaacaaagcgggcggcgcc
ggcgtgcaggtgacggcctacacccagaccatgagcgacatcgaggccaagatcggctcc
cgcgcgaaggccggtcagatcatcggcaacttcaacaacctgttcatgctgcgggtgcgc
gagaccgccacggccgaactccttaccaatcagctccccaaggtccagatctacaccagc
acgccggcgagcggcgccaacgacgcgatcaacaacaacaagaaggtagccttcacctcc
agctcgcacgaccaggtgcagatgaccagcgtgccgatgctcgagccggcccacatcatt
ggtctgcccaaaggacaagcgttcgcgctactcgagggcggcaatctctggaagatccga
atgccgctgccggcggtcgcccccgacgaggtgatgccgaaaagcctgcaggagctggct
gccggtatgcgcaagggccaggccgccaacagcgagtggtgggaggcgccgggatactcc
gccctgcaggatggtctgccccaggacctggtcgacgatttccgtcacctcggcaccggt
gaggatgccgcctga

DBGET integrated database retrieval system