KEGG   Parvularcula bermudensis: PB2503_00587
Entry
PB2503_00587      CDS       T01298                                 
Name
(GenBank) TrwC protein
Organism
pbr  Parvularcula bermudensis
SSDB
Motif
Pfam: TrwC AAA_30 AAA_19 Viral_helicase1 TraI_2B PhoH UvrD_C_2 AAA_16 AAA Y2_Tnp Peptidase_M24
Other DBs
NCBI-ProteinID: ADM08198
UniProt: E0TAY9
Position
10839..13823
AA seq 994 aa
MVASIAAVSSASAGAAYYGKDNYYAKGGDAPEPSSWFGKGAASLGLKGGVETETFERVLN
GETLDGRRVGQREGETAEQAQARAHRPGIDLTFSPPKDVSLLLYIGGDKRILGAHRAAVD
QTLKWAERNLAGTRIRTGPSATPAVKTGNLVIARFEHDISRDKDPQLHTHAVIANITKTD
DGRWRALHNDPFFAHRKTLSLAYDATLRNALRELGYRVKLEDGKSGRYSVDGVPDGARAE
FSKGKDRIDSAAVGLKHPTPSARDKLAVKTRPAKDELRQEERVALRETRGAPWKATLEHT
VAVSVERQAQGHLQRPLDDRAVGRVGMEGLARRMAQNLFRPTKTLRLSENDPYKLERAAS
EKGYSARAAVSFGLRHHEEREAAFSLHHVRRTALEHAADGVTLRDIDRELRFLRANRKLL
VNAKDPNAESTTKRSLTHEERTLSLLQDAGRTGPLVPEQTLRSALESTHLTGGQKAAIGL
ILGGPNRLVGVQGYAGTGKTTMMRQTAALARDLAPLAKKDGYKVLGLAPTHSARKTLEES
GGFDSRTVSAFLREAGGGTLPPDIKNTIVLIDEASFLSTRNMNALLERLIALKPAKIVLS
GDRRQHGAVEAGRPFDIAQRAGLPTAIMKDIVRLPKDEGHRDQRAAVEAAAQGKVAVAMK
RLGANIVERPGNLAGGAVEAWRALPKDKQDKALLVAPSHRLREAINQGIRSELIANGRLS
AETMTISVLRSKNLTRAEAMSPRSYAAGDILQFHARLDAINAKKNTRRLVTAVDEERGRL
TLRNARGKDQTVPLSRLQGRYENTPYSLHREEPLELRRGDSVMFTRSNPDAGLSAMDAAK
VVGWDQERVSLNVSGTQRQFGRDDPALRSLTHGYAMTSHAAQGRTAKDVVAVMDSKERAL
TSQVGFYVSISRSADTLALIVNDKERVLNTMQRQTGLKTSAMETEGRIGDLTDLGTHQGT
GTTSSLSVPALAADQRNEATGNEQDSSLDQGLSL
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggtcgcctcgatcgccgccgtctcctcggcctccgccggggcggcctattacggcaag
gacaattactacgcgaagggcggggacgcgcccgaaccctcgtcctggttcggcaagggc
gccgccagcctcggcctcaagggcggggtcgagaccgaaaccttcgaacgggtgctgaac
ggcgagacgctcgacggtcgccgagtcggtcaacgcgaaggcgagaccgccgagcaggcc
caggcccgcgcccaccggcccggcatcgacctcaccttttcgccgcccaaggatgtttcc
ctcctcctctatatcggtggcgacaagcgcattctcggcgcccaccgggcggcggtcgac
cagaccctcaaatgggccgagagaaacctggcggggacgcggatccggacggggcccagt
gcgaccccagcggtaaagaccggcaatctcgtcatcgccaggttcgagcacgacatctcg
agggacaaggacccgcagctccacacccatgccgtcatcgccaatataacgaagacggat
gacgggcgctggcgggcgctccacaatgatcccttcttcgcccatcggaagactctgagc
ctcgcctatgacgcgaccttgcggaacgccctgcgggaactcggctatcgggtgaagctc
gaggacggcaagtccgggcgatattccgtagacggtgttcccgacggggcacgagccgag
ttctcgaaaggcaaggaccggatcgacagtgccgccgtcggactcaagcacccgacgccg
tccgcccgggacaagctcgcggtcaagacgcggcccgccaaggacgaactccgccaggag
gaacgtgtggcccttagggaaacccgcggggcgccctggaaggcgacgttggagcacacc
gtcgccgtatcagtagagcgacaggcgcaaggccatctacaacgaccgctcgatgaccgg
gccgttgggcgcgtcggcatggaaggtctcgcgcggcggatggcgcagaacctgttccgg
ccgaccaagaccctccgcctttccgagaacgatccgtacaagctcgaacgcgccgcctcc
gagaaaggttattccgcacgcgctgccgtcagcttcggcctgcgccaccacgaagagcgg
gaagccgccttctctctccaccatgtccggcgcaccgcgctcgaacacgccgccgacggg
gtcaccttgcgcgacatcgacagggagcttcgtttcctcagggcgaaccgaaagctgctg
gtgaacgcgaaagacccgaacgcggagagcacgacgaagcggagcctgacccatgaggag
cgcacgctctcgctcttgcaggatgccggacgcaccggtccgctggttcccgagcagacc
ctgaggagcgctctcgagagcacccatcttaccggtggccagaaagccgctatcggcctg
atcctcggcggtccaaaccggcttgtcggcgtgcagggctatgctgggacgggcaagacc
accatgatgcgccagacggcagcgctcgcccgcgacctcgcgccgctcgcgaagaaggac
ggctataaggtgctaggcctcgcccctacccattcggcaaggaagacgctcgaggagagc
ggcggcttcgacagccggaccgtttcggccttcctaagggaggcagggggcgggacgctt
ccgccggacattaagaacaccatcgtcctcatcgacgaagcgtctttcctctccacccgg
aacatgaacgcgctcctcgaacgcctgatcgccctgaagcctgccaagatcgtcctctcg
ggtgaccggcggcagcatggcgcggtggaggccgggcggcccttcgacatcgcgcagcgg
gcgggcctaccgaccgcgatcatgaaggatatagtccgcctgccgaaggacgaagggcac
cgcgatcagcgggcggcggtggaagcggcagcgcagggcaaggtcgccgtcgccatgaag
cggctgggggccaacatcgtcgagcgacccggcaaccttgccggcggtgccgtcgaggca
tggcgcgccctgccgaaggacaaacaggacaaggcgctgctcgtcgccccgagccaccgc
ctgcgagaggcgatcaatcagggtatccgatcggagctgatcgccaatggacggctgagc
gcggagacaatgaccatctcggtgctgcggtcaaaaaacctgacccgggccgaggcgatg
agcccgcgcagctatgcggctggcgacatcctccaattccatgcccggctcgatgccatc
aacgcgaagaagaatacgcgccggctcgtcaccgcagttgacgaagagcgcggccgcctc
accttgcgcaatgcccgcggaaaggatcagacggtgccgctctcgcgccttcagggtcgc
tatgaaaacaccccctactcgcttcatcgggaggaaccgctcgagctgcgccgcggcgac
agcgtgatgttcacaaggtccaatcctgacgcgggcctgtccgcgatggacgcggcgaag
gtggtcggctgggaccaggagagggtttcgttgaatgtgagcggaacgcagcgccagttc
gggcgcgacgatccagcgctccgctcactgacccatggctatgcgatgacctcccatgcc
gctcaaggccgaacggcgaaagacgtggtcgccgtgatggattcgaaggaacgggcactc
acgagccaagtcgggttttacgtgtcgatcagtcggtcagccgatacccttgcgctcatt
gtgaatgacaaagagcgtgtactgaacacgatgcagcgacagacgggactgaagacgtcg
gcgatggagacggaaggacggattggggatttgaccgatctcggaacgcatcagggcacg
ggcacgacaagcagtctgtcggtgcctgccttagcagccgaccagagaaacgaggcaacc
ggcaacgagcaagacagctctctcgatcaaggtctgtcgctctga

DBGET integrated database retrieval system