KEGG   Physeter catodon (sperm whale): 102974967
Entry
102974967         CDS       T06011                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102974967 (ANKRD53)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102974967 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 102974967
NCBI-ProteinID: XP_023989277
UniProt: A0A2Y9TI62
Position
12
AA seq 498 aa
MRLAEKASASCGDSAARRPTWAWERVGGRRGAGNRSGLPERPGVERRGSAGSVSLGEVRD
QRAIGSYHELFAASLGNLEWLRFCLNRHRAEIPADDKGFTAIHFAAQSGKLACLQVLVEE
YKFPADLPTNNGQTPLHLVIHNDTKTMALPCIHCLIKQGAALNTQSCNGSTPLHLAAREG
LLSCVKVLVQKGANVHAQDAMGCKPIDYCKIWNHRICARFLKDAMWKQDKKDFAHEMGKL
KRLKNQLALMEEDYLTEYQKEHQILREADFKKWLHRKLLPQGQSLIRNTQGEPRPPPQAT
VLFKTPKHGALWPPKSFYPSREASLRQTLQPSQPSVMPTPTCKQPMVRRPKVWNRSNNPV
RSPTAPIGYPQGIRLGVHPDPRPEHDFPCFLEVRSDGHGGALLRTVAGNQVVPVPRLPLE
VIIRELYPSAQPCRMEVPQGFCSVTMREVPRKRRLGDGTFWTDTLSMNLRETFDEGFLAA
VRAHQGLPTLPSPKPPPT
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaggctggcggagaaggcgtcagccagctgcggcgactcggcggcccggcggcccacg
tgggcctgggagcgggtgggcgggcgtcggggcgcgggaaaccgctcgggcctccccgag
cggccgggcgtggagcggcgggggtcggccggctccgtgagtctaggcgaggtgcgggac
cagagggcgatcgggagctaccacgagctgttcgcggcctcgctgggcaacctggaatgg
ttgcggttctgtctaaatcggcaccgtgcggaaatcccggccgatgacaagggtttcact
gccatccactttgcagcccagagcggcaagcttgcatgcctgcaagtcttggtagaggag
tacaagtttcccgcggacctgcccaccaacaatggccagacacctctacaccttgtcatc
cacaatgacaccaagaccatggccctcccctgcattcactgtctgattaagcaaggggcg
gccctcaacactcaatcctgcaacggctccacacccctgcacctggcagcccgcgagggc
ctgctgagctgtgtgaaggtcctggtgcagaaaggtgccaatgttcatgcccaagatgcc
atgggctgcaagcccatcgactactgcaaaatatggaaccaccgcatctgtgcccggttc
ttgaaggatgccatgtggaaacaggacaagaaggactttgcccatgagatggggaaactg
aagaggctcaagaaccagctggccctcatggaggaggactacctgactgagtatcaaaaa
gagcaccaaattctgagagaagctgacttcaagaagtggctccatcgcaagctgctgccc
caaggccaatccctgatccgcaacactcagggagagccccgtcctccaccccaggccact
gtgctcttcaagacccccaagcacggggcactgtggcctcccaagagcttctacccctcc
cgagaggcgagcctgcgacagacactgcagcccagtcagccctcggtgatgcctacaccc
acctgcaagcagcccatggtcaggcggcccaaggtgtggaatcgcagcaacaaccctgtc
aggtcccccaccgccccgatcggctacccgcagggcatccgcctgggcgtgcatcccgac
cccaggccggagcacgacttcccctgcttcctcgaggtgaggtccgacgggcacggcggt
gcgctcctgcgcacggtggccggcaaccaggtggtgcctgtgccccgtctgcctttagag
gtgataatccgtgagctgtacccgtcggcgcagccgtgcaggatggaggtgccccagggc
ttctgttctgtcaccatgagagaggtgccccggaagcggcgcctgggtgatggcaccttc
tggaccgacactctgagcatgaacctgcgagagacgtttgacgaaggcttcctggcagct
gtgcgggcccatcaagggctcccgactctgccctcccccaaaccaccccccacttaa

DBGET integrated database retrieval system