KEGG   Physeter catodon (sperm whale): 102988910
Entry
102988910         CDS       T06011                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102988910 (AHRR)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102988910 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 Herpes_U5
Other DBs
NCBI-GeneID: 102988910
NCBI-ProteinID: XP_023974272
UniProt: A0A2Y9SD89
Position
8
AA seq 685 aa
MMIPPGECLYAGRKRRKPIQKQRPAMGAEKSNPSKRHRDRLNAELDRLAGLLPLPPDIIS
KLDKLSVLRLSVSYLRVKSFFQALQQPAAGAPSPGDRDPRGGSAVLEGRLLLESLHGFAL
VVSAEGMIFYASATIADYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQAGCGQ
NLLSETGEDAVLGRLLRAQEGAAGWPTEYSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKL
KFLFGQKRRAPSGAALPPRLSLFCVVAPLPTAVKMQSVCLRAKHRVDVSATLDTKAKAAA
SLCEPELHGKPSYLAGRGNGGNGLSVFRRPADACHWGRLAPRAPCLCLWGGHDRLHPPPE
GAAGDGRGEELGGVPRGPSCPRERRDVPPYGCHLETQGPSKHLNWTQGRHGQDGGTKLKL
EPGKGDPFLPYPGTQGAVHAVRSPAGSHQPKAPPGPCAGRTSRALRDGHQGQAPPPTSCP
FPQGSLEDGPPRPGGQHLPAGCYPTEDKLRGVPMPPGAPCNPTLSLDVPIKMESESGSED
AADGYSVSPSQAWLGAGDVAKRQLVTFPTRMHLKMEPDSRHPLYSPPLGPGLLGAHPRPS
RELAPLYPAHCACLEPPPRLCAGGHHSPSLGCDCQAPRPAPVVKLEPLDSPPWAAHSQGG
APGMLPRGALATRMPPRDPECTFLP
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgatgattccgccgggggagtgcctgtacgccgggaggaaaagaaggaagcccattcag
aaacagaggcccgccatgggcgccgagaagtcgaacccttccaagagacaccgcgaccgc
ctcaacgccgagctggaccgcctagccggcctgctgccgctgccgcccgacatcatctct
aagctggacaagctttcggtcctgcgcctcagcgtcagttacctccgggtgaagagcttc
ttccaagccctgcagcagccggcggccggtgccccctcaccaggagacagggatccgcgt
ggagggtctgccgtgctggagggaaggctgctgctggagtccctccacggctttgctctg
gtggtaagcgcggaagggatgatattctacgcgtcagcaacgatcgcggactatctgggc
ttccaccagacggacgtgatgcaccagaatatttacgactacatccacgtggacgatcgc
caggacttctgccggcagctgcactgggccatggaccctcctcaggctggatgtgggcag
aacctgctctcagagacaggagaggacgccgtcctggggaggctgctccgggcccaggag
ggcgccgcgggctggcccaccgagtactcggccttcctgacgcgctgcttcgtctgccgc
gtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagtttcaagggaaacta
aaattcctgttcgggcagaagaggagggccccgtcgggggccgccctgccccctcggctc
tccctgttctgcgtcgtggcgcccctgcctactgcggtgaagatgcagagtgtgtgtctg
agggcgaagcacagggtggacgtctcggccacgctggacacaaaagcaaaagctgccgca
agtctctgtgaaccagaattgcacgggaaacccagttacttagcagggaggggcaacgga
gggaacggcctgtccgtgttcaggaggcccgcggacgcctgccactggggccgccttgcc
ccccgggccccctgcctgtgcctctggggtggccacgaccgcctccatccgccccccgag
ggggccgcaggggatgggcgaggagaggaactgggcggggtgccgaggggcccctcctgc
ccaagggagcggagggacgtccccccgtacggctgccacctcgagacacagggaccctcg
aagcacctgaactggacgcagggcagacacggtcaggacggcggcaccaagctgaagctg
gagcccggcaagggtgacccgttcctgccctacccgggcacacagggcgctgtccacgcc
gtcaggagtccagctggctctcaccagccaaaggccccccccgggccctgcgccggccgg
accagcagagccttgcgggatggccaccagggccaggctccccctcccaccagctgcccc
ttccctcaggggagcctggaggacgggcctcctcggccgggagggcagcatctccccgcg
gggtgctatcccactgaggacaagcttcgaggtgtcccaatgcccccgggagccccgtgt
aaccccacattgtcactcgacgtgcccatcaagatggagagcgaatccgggtccgaggac
gcggcggacggctactctgtgtccccgagccaggcgtggctgggggccggcgacgtggcc
aagaggcagctggtcactttccctaccaggatgcacctgaagatggagccggactccagg
caccccctctacagcccacccctggggcccggcctgctgggggcccaccccaggcccagc
agggagctggccccgttgtaccccgcacactgcgcctgcctggagcctccgccccgcctc
tgtgccgggggccaccactcccccagcctgggctgtgactgccaggctccccggcctgcg
cctgtagtcaagcttgagcccctggactcgcccccgtgggccgctcacagccagggtggg
gcgcccgggatgctccccaggggcgccttggcgacacggatgccacccagagaccccgag
tgcacattcctgccgtag

DBGET integrated database retrieval system