KEGG   Physeter catodon (sperm whale): 102996576
Entry
102996576         CDS       T06011                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcad01002]
    102996576
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102996576
Peptidases and inhibitors [BR:pcad01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102996576
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin_5 ADAM_spacer1 Reprolysin_2 Peptidase_M10 TSP1_CCN
Other DBs
NCBI-GeneID: 102996576
NCBI-ProteinID: XP_028353170
UniProt: A0A455BVY9
Position
13
AA seq 988 aa
MGSELLRDPSLGAQFRVHLVKMVILTQPEDAPNITANITASLLSVCEWSRTVNPEDDTDP
GHADLVLYITRFDLELPDGNRQVRGVTQLGGVCSSSWSCLITEDTGFDLGVTIAHEIGHS
FGLEHDGAPGSGCGPSGHVMASDGAAPARGGPAWSPCSRRQLLSLLSAGRARCVWDPPGP
QSQPAGHPPEAHPGLYYGADEQCRVAFGPTAVACTFRREHLDMCQALSCHTDPLDQSSCS
RLLIPVLDGTECGVGKWCSKGQCRSLAELAPVGAVHGHWSSWGPASPCSRSCGGGVVTRR
RQCNNPRPAFGGHACVGADLQAKMCNSQACEKTQLGFMSEQCAQTNGEPLRLSPGSTSFH
RWVTAEQYSRGDALCRYLCRAVGESFLVRRGDSFLDGTRCVPGSPREDGTLSLCVSGSCK
TFGCDGRMASGQVRDVCQVCGGDNSTCRPQNGSFTAGRAREYVTFLTVTPNLTSIYVVNH
RPLFTHLAVRIRGRYVVAGNESISPSTTYPSLLEDSHVQYKVTLTEDRLPRLEEIRIQGP
TQDDMEIQVYRRYGEEYGSLARPDITFTYFQPERRPAWAWAPVRGACSVSCGAGLRWVTH
SCRDQAANEWAEAARCAGSRQPAAWSESCAPMPCPPSWAAGDFGPCSASCGGGLQERAVR
CVQAQGGLLRTVPRSRCRALAPQPAAVETCYSQPCPRREVPDACSSACGTDPAVQNTTCV
QGADGMGAPATAGPCSADEKPPALEPCIEVACPPGWGRPDAQSPGEKAAPPAGSARPEAR
AAHVWTPLAGPCSVSCGQGLMELRFVCMDSALRTAVREELCDLANKPGSRQEVCQAAPCP
AWWETRALAPCPVTCGGGRVPLAVRCVRVDQGRLVSLPHSKCRPVPRPRPLQDCSPEPCP
ARWRYQLAACSVTCGGGVAQRILYCARAHGEDKDEEILPDTQCQGLPRPERQEACSPEPC
PPRSAAPGRSVGSLNSWPVPTPGQARGG
NT seq 2967 nt   +upstreamnt  +downstreamnt
atggggtcagagctgcttagggacccatccctgggagctcagttccgagtgcacctggtg
aagatggtcatcctgacgcagcctgaggatgctccgaatatcacagccaacatcaccgca
tcactgctgagcgtctgtgagtggagcaggacagtcaaccctgaggatgacacggatccc
ggccatgctgacctggtcctctacatcaccaggtttgacctggaactgcctgatggtaac
cggcaggttcggggggtcacccagctgggtggtgtctgctcctcctcctggagctgcctt
atcactgaggataccggcttcgatctgggggtcaccatcgcccatgagattgggcacagt
ttcggcctggagcacgacggcgcaccgggcagcggctgcgggcccagcggccacgtgatg
gcttccgacggcgccgcgcccgcccgcgggggcccggcgtggtccccctgcagccgccgg
cagctgctgagcctgctcagcgcaggacgggcgcgctgcgtgtgggacccgccggggccg
cagtcccagcccgcggggcaccctcccgaggcgcaccccggcctgtactacggcgccgac
gagcagtgccgcgtggccttcggtcccacggcggtcgcctgcaccttccgcagggagcac
ctagacatgtgccaggctctctcctgccacacagaccctctggaccaaagcagctgtagc
cgcctcctgattcctgtcctggatgggacagagtgtggcgtggggaagtggtgctccaag
gggcagtgccgctccctggcggagctggcccccgtgggggcggtgcatgggcactggtcc
agctggggcccggccagtccttgctcccgctcctgcggaggaggtgtggtcaccaggaga
cggcagtgcaacaaccccagacctgcctttggggggcatgcgtgcgtaggtgctgacctc
caggccaagatgtgcaacagccaggcctgcgagaagacccagctggggttcatgtcggag
cagtgcgcacagaccaacggggagcccctgcgcctctccccgggcagcacctccttccac
cgctgggtcacggccgagcagtacagtcgaggggacgctctgtgtagatatctgtgccgg
gccgttggcgagagcttccttgtgaggcgtggggacagtttcctggatgggacacggtgt
gtgccaggcagccctcgggaggatgggaccctgagcctgtgtgtgtcgggcagctgcaag
acgtttggctgtgacggcaggatggcctccgggcaggtgcgagacgtgtgccaggtgtgt
ggcggggacaacagcacgtgccgtcctcagaatggctctttcacggccggaagagccaga
gagtatgtcaccttcctgaccgttacccccaacctgaccagcatatacgtcgtcaaccac
aggcctctcttcacgcacctggcagtgaggatccgtgggcgctacgtcgtggccgggaat
gagagcatctctcccagcaccacctacccctccctcctggaggacagccacgtccagtac
aaagtgaccctgactgaggaccggctgccccgcctggaggagatccgcatccagggcccc
acccaggacgacatggagatccaggtttacaggcgctacggcgaggagtacggcagcctc
gcccgcccagacatcaccttcacctacttccagcccgagcgtcggccggcctgggcgtgg
gctcccgtgcggggggcctgctcggtgagctgtggggcagggctgcgctgggtgacccac
agctgtcgggaccaggccgcgaacgagtgggcggaggctgcccggtgcgcagggagccgg
cagccggcggcgtggtccgagtcgtgtgcgcccatgccctgtcccccgtcctgggcagcc
ggagacttcggcccgtgcagtgcctcctgcggagggggcctgcaggagcgggcggtgcgc
tgtgtgcaggcccagggcggcctcctgaggacggtgccccgctcccggtgcagagcgctg
gccccgcagccggcggccgtggagacctgctattcccagccctgcccccggagggaggtg
ccagatgcgtgctcgtcggcctgtggaacagatccggccgtgcagaacacgacatgtgtg
cagggggcagatggcatgggggcaccagcaactgctgggccctgctccgcagacgagaag
ccgcctgcccttgagccctgtatcgaggtggcatgtcctccgggctggggccgtccagat
gcccagtctccaggggagaaggctgcacccccagcgggcagtgccaggccagaggctcgt
gcagcacacgtgtggactcccttggcggggccgtgctccgtctcctgtggtcaaggcctg
atggagctgcgtttcgtgtgcatggactctgccctcaggacagccgtccgggaagagctg
tgtgacctggcaaacaagcctgggagccggcaggaggtctgccaggctgccccttgcccg
gcttggtgggagacccgagccttggcaccgtgccccgtgacctgtggaggggggcgggtg
ccgctggctgttcgctgtgtgagggtggaccaaggccgcttggtctccctgcctcattcc
aagtgccggccggtgccccggcccaggcccctccaggactgcagcccggagccctgccct
gccaggtggcggtaccagctggcggcctgcagcgtgacctgtgggggaggagtcgcgcag
aggatcctgtactgcgcccgggcccacggggaggacaaggacgaggagatcctgccggat
acccagtgccaggggctgcctcgcccagagcggcaggaggcctgcagcccagagccctgc
ccgcccaggtcagcagccccaggacgttcagtaggcagcctgaactcctggcctgtgccg
acgccgggccaggcccgtgggggttaa

DBGET integrated database retrieval system