KEGG   Phascolarctos cinereus (koala): 110196567
Entry
110196567         CDS       T05867                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04080  Neuroactive ligand-receptor interaction
pcw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110196567 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110196567 (APLN)
SSDB
Motif
Pfam: Apelin DUF5302
Other DBs
NCBI-GeneID: 110196567
NCBI-ProteinID: XP_020825540
Position
Unknown
AA seq 76 aa
MNLSLCLQALLLLWLSLTSVCGGPLVEALDRKELEEGNIRTLVQPKVARTGGPWQGGRRK
FRRQRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatttgagcctgtgcttgcaggcgctcctgcttctctggctctccttgacttcggtt
tgtggagggcccctggtggaggcgttggacaggaaggagctggaggaagggaacattcgg
accctggtgcagcccaaagtggcaagaactgggggaccctggcagggcggtaggaggaag
ttccgaaggcagcggccccgcctttcccacaaaggccccatgcctttctga

DBGET integrated database retrieval system