KEGG   Phascolarctos cinereus (koala): 110205378
Entry
110205378         CDS       T05867                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcw01002]
    110205378 (ADAMTS13)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     110205378 (ADAMTS13)
Peptidases and inhibitors [BR:pcw01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   110205378 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 Reprolysin_4 ADAM_spacer1 TSP1_spondin TSP1_CCN Reprolysin_3 Pep_M12B_propep Reprolysin_5 Reprolysin_2 Peptidase_M10 CUB
Other DBs
NCBI-GeneID: 110205378
NCBI-ProteinID: XP_020837622
UniProt: A0A6P5JTQ6
Position
Unknown
AA seq 1590 aa
MVSTWVIFASAFFFLGSFQLPDFQERFLMALEPENIFFYFGAISTLEALEFDVLQLSCAC
EDHQISRLYCKTLHCSFQALGELYTFQFPEELSLLIPSFTSQWVINSSLWLLKQYPDSCF
TGGRVLLPPGAAAKITYCAGQLQGEVIVRGEQLYIQPLKREHWSLALDRSHAQPHLIHKI
TQRASGTLQAHRLSPRISKRALGSVKHLELLVVVGHDVYEYHKEDTERYVLTNLNIGAEL
LRDVSVGAQFRVHLIKMIILTEPEADLSITTNLTSSLLSVCEWSQRINPPDDTHPLHADL
VLYITRFDLELSDGNKQVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHEIGHSFGIDH
DGADKNSCSSNDHIMALGGTPNSIGLTWSECSREQFLHFVSTGKASCVNDLPHLEGTIPQ
AEPGLYYGADEQCRVAFGSAAIACTFSRDDVDMCQVLSCHTDPQDLTRCSRILIPLLDGT
ECGVNKWCSKGHCRSLEELTPVSLVHGQWSSWGPPSTCSRTCGGGVITRRRQCNNPRPAF
GGLDCAGADLKAELCNTQACVKTQLEFMSEQCAATDGKPLYLTPGVPTFYSWKSAAQYSQ
GNDLCKHMCWASGKNFIVSRGASFLDGTRCVPADHQAEGTISVCVMGKCRAFGCDGRMDS
GHVKDVCQVCGGDNTTCSRVNGSYTGGRAQEYVTFLTIPPNFTTVHITNQKPLFTHLAVK
IRGQYVVSGKRSISLNTTYPSVLEDNQIEYKVFLSKEKMPHLEEIHIRGPTQEDIEIQVY
RKYGNEYGNLTSPEITFSYFKPKQQQAWVWAVVHGACSVSCGEGLRQVSYSCFDQAQDKW
TDDVYCGGTMKPLSWEELCVPGPCPPHWAAGDFGPCSTTCGGGVRERTISCVKVEGNLTL
MLPESYCKASLQPVATETCNPQLCLARWKVSEPGPCSSVCGLGLAQRNVTCMQEGDGLEG
PVDNRLCSMEEKPSHFLPCVVTVCPLGWNTQEPGSFLEEAMDQLGASWKENLTVHVWSPV
AGECSVSCGTGIRELRYVCLDFASRKEVQEEKCSPVSQPANQMMACHAASCPPRWEIKAL
APCPVTCGGGKVPLSVHCVRQNEGLTISLPHFKCGGMPRPSSYRDCSPEPCPARWRHKLA
SCSVSCGGGVVQRILYCARAFGENEEEIVPDSQCQELPRPEEQEPCNLDPCPPRWKVVSS
SSCSASCGLGIAMRSMICVQLDHGEEAEVEEEACATLERPPASIPCIITDCTYQWHFSDW
MECSASCGNGIQRRHDFCVRPHQTHAPVPAIFCQHIPKPVTVRGCSAGPCERQVIPKPKA
QEEATSAISRTTTAPALTFESPQYRALAVPNHQLSSSIQPKESLKQDENTGTCGKQYLGP
IGTINMTGMQVAKCAVSIGRPLGEVVAFQVLESSLNCSVGEMLLFWGRLTWRKTCENLAG
VTFVSKTNTLVVRQRLVFPENGVVLQYWSQVATENYHKECDVQLFGPRGEIVSPPRKHNV
RNQGGCRVFINVAPEARIAIHALTIDLGTEANQTSDSYILIRDMHNMKIVTFHGQQLFYW
ESVGSQAEIEFSESFQEDHISFRGQYWILK
NT seq 4773 nt   +upstreamnt  +downstreamnt
atggtcagcacatgggtaatctttgcttctgctttcttctttctgggatctttccagctt
ccagatttccaggagagatttctgatggctttggagccagagaatattttcttttatttt
ggtgctatttccaccctagaagccctagagttcgatgtgcttcagctcagctgcgcttgt
gaagaccaccagatctccaggctgtattgtaagacactgcactgctccttccaggccctg
ggagaactctataccttccagttccctgaagagctcagcctcctgatcccttcctttact
agccaatgggtgattaactcctctctctggctactgaaacaatatccagacagctgcttt
acaggaggcagggtcctgttgccccctggggctgctgctaagattacttactgtgcaggg
cagttgcaaggagaagtcatagtgaggggtgagcagctttacattcaacctctgaagagg
gaacactggagcctggcgctggaccgcagtcatgcccagccccatcttattcacaagatt
actcagagggcatcagggaccctacaagctcaccgactttctcctcgaatctctaaacgg
gccctaggaagcgtcaaacacctggagctactggttgtggtgggccatgatgtctatgag
taccacaaggaagacacggagcgatatgtcctcaccaacctcaatattggggcagaactg
ctgagagatgtttccgtaggagcccagttccgagtccacctgataaagatgatcattctg
actgagccagaggctgatctgagtattaccaccaatctcacctcctcactgctcagcgtg
tgtgaatggagccagaggatcaatcccccagatgacacccacccactccatgctgacttg
gtcctctacatcacaaggtttgatctggagctgtcagatggcaacaagcaggtacgggga
gtgacccagcttgggggtgcttgctcctcctcctggagctgccttatcacagaagacacg
ggctttgatctgggggtcaccattgctcatgagattgggcacagctttggtattgatcat
gatggggctgacaaaaacagctgcagcagcaatgaccacatcatggcccttgggggcacc
ccaaacagcattggcctcacgtggtcagagtgcagccgcgagcagtttctacactttgtt
agcacagggaaggcaagctgtgtgaatgatctgcctcacctggaaggaacaatcccccag
gcagagcctggcctctactatggagcagatgagcagtgccgagttgcctttgggagtgcc
gccattgcctgtaccttctccagggatgatgttgatatgtgccaagttctctcctgccat
acagaccctcaggacctcacccgctgtagtcgcatccttatcccactcctggatgggact
gaatgtggagtcaataagtggtgctctaagggccactgccgttctctagaagagttgacc
ccagtctccttagtacatggacagtggtctagttggggccctcctagcacttgctcccga
acctgtggaggaggagtcatcaccagaagacggcagtgcaacaaccccagacctgccttt
ggtggtcttgactgtgcaggagctgacctcaaggctgagctgtgcaacactcaggcctgt
gtgaagacccagctagagttcatgtctgagcaatgtgctgcgactgatgggaagccacta
tacctcactccgggggttcccaccttctatagctggaagtcagctgctcagtatagccaa
gggaatgatctgtgtaagcatatgtgctgggcatctggaaagaatttcatcgtgagccgt
ggggcaagtttcctggatggtacgcgatgtgtgcctgcagatcaccaggcagaggggacc
ataagcgtctgtgtgatgggcaaatgcagggcatttggatgtgatggcaggatggattct
ggacatgtgaaggatgtgtgtcaggtctgtgggggagacaacaccacatgcagcagagtg
aatggctcttacactggagggagggcccaagagtacgtcacattcctgacaattcctcct
aatttcaccactgtgcatatcaccaaccagaaaccactcttcacacacctggctgtgaag
ataagaggacagtatgtggtatctggcaagaggagcatctcgttaaacaccacctacccc
tcagtcctggaagacaatcagattgagtacaaggtgttcctcagcaaggaaaagatgccc
cacctagaggagatacacatcagaggacccacccaagaggacattgaaatacaggtttac
aggaagtatggaaatgaatatggaaacctcaccagccctgagatcactttcagctacttc
aagcctaagcagcagcaggcctgggtgtgggcggtggtacatggggcctgttcagtaagc
tgtggggaaggattacgtcaagtgagttatagctgctttgaccaagcccaggacaaatgg
actgatgatgtctactgtggagggaccatgaagcccctgtcatgggaggaactctgtgtc
cctgggccatgcccaccacactgggcagcaggagactttggtccttgtagcacaacctgt
ggaggaggagtgagagaaaggacaataagctgtgtgaaggtggagggcaaccttaccctg
atgttaccagaatcctattgcaaagcttctctccagcccgttgctacggagacctgcaac
ccccagctctgccttgccaggtggaaggtgtcagaacctggtccatgctcttccgtctgt
ggtctgggtctagcccagaggaatgtgacatgcatgcaagaaggggatggcctggaaggc
ccagtggacaacaggctatgctctatggaagaaaaaccttctcacttcttgccatgtgtg
gtgactgtctgccccctgggctggaatactcaagaacctggatctttcctggaagaagct
atggaccaactgggagcttcctggaaagagaatctaacagtgcatgtgtggagtccggtg
gctggggaatgctcagtctcctgtggtacaggcataagggagctacgctatgtttgtttg
gactttgccagcaggaaagaggtccaggaagagaagtgtagcccagtgagccagccagca
aatcagatgatggcctgtcatgctgcttcctgtccacctaggtgggagatcaaagctctg
gccccttgtccagtgacctgtggaggagggaaagtgccactctctgtccattgtgtgagg
cagaacgaaggcctgaccatcagtcttcctcatttcaagtgtggggggatgccccggcct
agcagctaccgggactgcagtccagagccctgtcctgccaggtggcggcacaagctggcg
tcctgcagtgtaagctgtggaggaggggttgtccagaggatcctctactgtgccagggct
tttggggagaatgaggaggagattgttcctgacagccagtgccaggagctcccacgccca
gaggaacaggagccctgcaacctagacccttgtccacccaggtggaaagtagtgtcaagc
agctcatgctcagctagctgtggtctgggcatagccatgcgctccatgatctgtgtgcag
ctggaccatggagaagaggcagaggtggaagaggaagcctgtgccaccctggagaggccc
ccagctagcatcccttgcattataacagactgcacctaccaatggcatttcagtgactgg
atggagtgttctgcctcatgtgggaatggaatccagcgccgccacgacttctgtgtcaga
ccccaccagacccatgctccggtacctgcgatcttctgtcagcacattcccaagcctgta
actgtgaggggctgctcagctgggccctgtgagaggcaggtgatacccaaaccgaaggca
caggaggaagccacaagtgctataagccgaacaacaacagctcctgctcttacctttgag
agtccccagtacagagccttggctgtccccaaccaccaactttcttcatctattcaaccc
aaggaatccctgaagcaggacgagaacactggtacctgtggaaagcaataccttgggcct
atagggaccatcaatatgactggcatgcaggtggccaagtgtgcagtgtccatcggtcga
cctctgggggaggtggtggccttccaagtcctggagagctccctcaactgtagtgttggg
gagatgctgctgttttggggacggctcacctggaggaaaacctgtgagaatttggcaggt
gtgacattcgtctccaaaaccaacactctggtggtgagacagcgcctggtattcccagaa
aatggggtcgtgctacagtactggagccaagtagccacagaaaattatcacaaagaatgt
gatgtgcaactcttcggtcctagaggggaaatagtgagtcctccacggaagcacaatgtg
agaaaccaaggaggatgtcgagtcttcatcaatgtggctccagaagcccggatagccatc
catgccctgaccattgatctggggacagaagctaatcagacttctgacagctacattttg
atccgtgacatgcacaacatgaagatagtaacattccatggacagcagttattctactgg
gagtcagtggggagccaagctgaaattgagttcagtgagagcttccaagaggaccacatc
agttttcgaggtcaatactggatccttaaatag

DBGET integrated database retrieval system