KEGG   Phascolarctos cinereus (koala): 110218451
Entry
110218451         CDS       T05867                                 

Gene name
ANKRD53
Definition
(RefSeq) LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110218451 (ANKRD53)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    110218451 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 110218451
NCBI-ProteinID: XP_020856845
Position
Unknown
AA seq 722 aa
MSVCPLCSGQGPEWVRVVQEPPYSIQIQPPDDPLGSKDVQPFLPTWHTTDQDDPGSHRQS
YNRYRASTGTPFRKRAFAQNQELLAACLGNLEWLHHSLKHRKGVRSDCRGFTALHLAAER
GHLDCMIALVDRYKFPLSMTTNKGWTPLHLAISKENSGVALKCVQFLLEKGAPVNVQNRN
GITPLHLAAWEGMLDCIKVLVKAGADVHALDRQNRKSIDLCRLWNHRECARFLKDAMWKQ
DKKDLAEEMGQLSQLKKRLLVMQNKYLLEKKKEKEAQNQVAFTQWLQIKPLPRLPKITIL
EPSRVTKESAPVTKESAPAMEKSARFTKKSVPEPPRFTMEASHIKKYPHVTKPQPPRRPH
PPCKRRPVLILPARRRFRPLEGNPAFEHRHPLNRSSLFKPSHSELSVPVHLPTRLRSLVL
VQPPVSSFQLPFSHSPSPPLTVRSRGSTLFKSAVGASSSSRRATIFHPSPSFPLSLQYYP
RSNHRHSYPLLHTPSPQRTLSESQLQYGQIEAIFPAASPPMHPLALLDIHLADIPLTAPP
ARSSSPFHWAAKWNSSTKADARPVTRIAFPQVVRLGVHPDPTPEPDFCNFLKFYPNGEGG
ALIQTADGQWIFPVPRLPFKVLLRELAPSGRSQRLKVPEGLRRITVQDLPRRRYPGDQCF
WTDSMAMSLRDTFDPAFISLVRKHQGLPALSPTSSSSSSLTSSVALRPCWALLFYAFNNP
PS
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgtccgtctgccctctgtgctctggccaagggccagaatgggttcgcgtggtccaggag
cccccgtactcgatccagatccaaccacctgacgaccctttgggaagcaaagacgtacag
cccttcttaccaacatggcacaccacagaccaggacgaccccgggagccaccgacaatct
tacaaccgctaccgcgccagcaccgggacccctttccgaaagcgggcgtttgcgcaaaac
caggaactgctggcagcctgcttgggtaacctggagtggcttcatcacagcctgaagcac
cgaaagggcgtccgctctgactgcaggggcttcacagccctccacctggcagctgaacgt
ggccacctggactgcatgatagcgctggtggatcgatacaagttcccgctgtcaatgacc
acgaacaagggctggactccccttcacctggccatcagcaaggaaaactcaggcgtggcc
cttaagtgtgttcagttccttctggagaagggagctccagtcaatgtccagaatcgaaat
ggcattacccctctgcacctggcagcctgggagggcatgctggactgcataaaggtcctg
gtgaaagctggggctgatgtacacgccctcgacaggcagaacaggaagagcattgactta
tgcaggctgtggaaccaccgagaatgtgcccggttcttgaaggatgctatgtggaaacag
gacaagaaagacttggctgaagagatgggtcaactgagtcagcttaaaaagcgattgctg
gtcatgcagaataaatacctccttgaaaagaagaaagagaaggaggcccagaaccaagtc
gccttcacccaatggctccaaattaagcctctgcccagattgcccaagattacgatcctg
gagccctcccgggttacgaaggaatccgccccggttacgaaggaatccgccccggctatg
gagaaatccgcccggtttactaagaaatctgtcccggagcctcctcggtttacgatggag
gcctcccacattaagaagtacccccacgttacgaagccgcagcccccgcggaggcctcac
ccgccctgcaagcggcgccccgttttgattctccccgcccgccgaagattccgccccctc
gaagggaacccagccttcgaacaccggcacccccttaaccgttcttccctctttaagccc
tctcattccgagttatcagtcccggtccatctcccgacccgcctccggtcccttgtcctc
gtccagcccccggtctcctcgtttcagctcccattctctcatagcccctctccccctttg
actgtccgctcacggggctccactctgttcaagtcggctgtcggagcgtccagctcgtcg
cgccgggctacgatcttccacccgtcccccagcttcccgctaagcctccaatactaccct
aggtctaaccaccgccattcttatccacttctacacacgccatcaccacagcggactctc
tccgagtctcagctacagtacggccagatagaagctatcttcccagccgcaagcccgccg
atgcacccgctggctctcttagacatccacttagcggacatccccctaaccgctcccccg
gcccggtcgtcctcgcccttccactgggctgccaaatggaactcgagcaccaaggccgat
gcacgaccggtcacccggatcgccttcccgcaggttgtgcgcctgggtgtgcacccggac
ccgaccccggagcccgacttctgcaacttccttaaattctaccccaacggcgagggcggg
gcgctcatccaaactgccgacggccagtggatcttcccagtgccccgactgcccttcaag
gtcctgctccgagagctggccccgagcgggcgttcccagcgcctgaaggtgccggagggg
ctgaggcgcatcaccgtccaggacctgccccggaggcgctaccccggggatcagtgcttc
tggacagattccatggccatgagcctccgggacaccttcgacccagccttcatctccttg
gtgcgaaagcaccaggggcttcctgccctctcccccacctcctcgtcttcctcctccctc
acctcttcagtcgctctcagaccgtgttgggccctcctcttctatgcttttaataacccc
ccctcataa

DBGET integrated database retrieval system