KEGG   Phoenix dactylifera (date palm): 103720779Help
Entry
103720779         CDS       T03274                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pda00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103720779
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pda03041]
    103720779
Enzymes [BR:pda01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103720779
Spliceosome [BR:pda03041]
 Complex C
  Other components
   Step II factors
    103720779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 ABC_tran DUF2075 Sigma54_activ_2 Flavi_DEAD AAA_16 PhoH AAA_14
Motif
Other DBs
NCBI-GeneID: 103720779
NCBI-ProteinID: XP_008808919
UniProt: A0A2H3Z626
Position
Unknown
AA seq 1184 aa AA seqDB search
MAPAADDGLKKLEYLSLVSKICTELESHVGCGDKVLAEFITDLGRSSETVEEFDAKLKEN
GAEMPDYFVRTLLTIIHAIVPPKPKSAKPSSDQNQAKKRSSAFPALSCRDDPERAKELRR
EMERDAEMKAASEVRSRDDHRDRDRGQDRDRDRDRDRRRDRDRDREYRRERDRDGDRDRD
WDRHNRDRSHRRDRDRDRYDNSRAYDEEEEDGRDGRNPNLSSRRYADEPELYKVYKGRVS
RVMDTGCFVQLNDFRGKEGLVHVSQIANKRVANAKDAVKRDQEAFVKVISVSGQKLSLSM
RDVDQKTGKDLLPMRKNSEDEALRANPSSGNHGPVTRTGLSGITIVEEDENGPSRRPLKR
MSSPEKWEAKQLIASGVLDVREHPMFDDDADGLLYEEEGAEEELEIELNEDEPAFLQGQS
RFSIDMSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPM
PDTGERHLAQELRGVGLSAYDMPEWKKDAYGKALTFGQRSKLSIQEQRQSLPIYKLKKEL
IQAVHENQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEF
GCRLGEEVGYAIRFEDCTSPETVIKYMTDGMLLREILVDENLSQYSVVMLDEAHERTIHT
DVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPET
DYLDAALITVLQIHLTEPEGDILVFLTGQEEIDHACQCLYERMKGLGKNVPELIILPVYS
ALPSEMQSRIFEPAPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGIDSL
IITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTTVPEIQRINLGMTTLNMKA
MGINDLLSFDFMDPPSPQALISSMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLL
ASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKA
KNFSGPWCFENFVQSRSLRRAQDVRKQLLTIMDRYKLDVVSAGKNFTKIRKAITAGFFFH
SARKDPQEGYRTIVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLV
ELAPRFFKSADPTKLSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggcggctgacgacggcctgaagaaactcgagtacctctctctcgtctccaaa
atctgcacggagctcgagtcccacgtcgggtgcggcgacaaggtcctcgccgagttcatc
accgatctcggccgcagttccgagacggtggaggagttcgacgccaagctcaaggagaac
ggcgccgagatgcccgactacttcgtccgcaccctcctcaccatcatccacgccatcgta
cccccaaagcccaagtccgccaagccctcctccgaccagaatcaagccaagaagaggtcc
tccgccttccccgccctctcctgccgcgacgaccccgaacgcgccaaggagctccgccgc
gagatggagcgtgacgccgagatgaaggccgcatctgaggtccgcagccgcgacgatcac
cgcgatcgtgatcgcggccaagatcgggatcgggaccgagaccgagaccggcgacgtgat
cgagatcgagatcgagagtataggcgagagagggatagagatggagatagagacagagac
tgggacagacataatagagataggagtcacagaagggatagagatagagataggtatgat
aattctagggcatatgacgaggaggaagaagatggcagggatgggagaaaccctaacctt
agtagtcggaggtatgcggacgagccggagctctataaggtgtataagggtagggtttcg
cgagtgatggatacggggtgctttgtccagttgaatgatttcagggggaaggagggtctg
gtccatgtttcccagattgcaaataaaagggtcgccaatgcaaaggatgcagtgaagcgc
gatcaagaagcattcgtgaaggtgatctcagtgtctgggcagaaacttagcctttccatg
agggatgtggaccagaaaaccggaaaagatctgcttccaatgaggaagaactcggaggat
gaggcattgagggcgaacccttcaagtggcaaccatgggccggtgacaaggactggcctt
tcgggcatcacgattgtggaggaggatgagaatggaccgtctcggcggccgttgaagagg
atgagctcaccagagaagtgggaggcgaagcagctgattgcttctggggttttggatgtc
agggagcatccaatgttcgatgacgatgccgatgggctgctgtatgaggaagagggagct
gaagaagagctggaaattgagcttaatgaggatgagcctgcattcttgcaagggcagagc
cggttctcaattgacatgtcccctgtcaagattttcaagaatcctgaaggttctttgagc
agggcggcagcactccagtcagctctcattaaggagaggagggaggtccgagagcagcag
cagaggacaatgcttgattccatcccgaaggatcttaaccgcccatgggaagaccctatg
ccagatacaggtgagaggcaccttgctcaggagctgaggggtgttggattgtcggcctat
gacatgcctgaatggaagaaagatgcatatggaaaggctttaactttcgggcagaggtca
aagctttcaatacaggagcaaaggcagagtcttccgatctataaactgaagaaagagctg
attcaagctgtgcatgaaaaccaggttctggtcgtcattggtgagaccggttcagggaag
acaacacaagtcactcaatatctggcggaggcaggttacacaacaaggggaaaaattggg
tgcacacagcctcgtagggtggcagcaatgtcggttgctaagagggtggcagaagaattc
gggtgccgtttgggagaagaagttggttatgctattaggtttgaggactgcactagtcca
gagacagtgatcaagtatatgacagatggtatgcttcttagggagatcttggtcgatgaa
aacctttcacagtactctgttgtcatgcttgatgaagctcatgagagaacaatccacact
gacgttctttttggtttgctaaaacagctagtgaagcgcaggcctgaccttcggttgata
gtcacttctgccacacttgatgcagaaaagttctctggttatttctttaactgcaatatt
ttcaccattccagggagaacatttccagtggagatactctacacgaagcagccagagact
gattacttagatgcagctctaatcactgttttgcagatccacttgacggaacccgagggt
gatattcttgtcttcttgactggccaagaggaaattgatcatgcttgtcagtgtctttat
gagagaatgaaaggtttaggaaagaatgttccagagttgattatcttgccagtatacagt
gctcttcctagtgaaatgcaatccaggatttttgaacctgcacctcctggaaagaggaaa
gtggttgtggctactaatattgccgaggcttctttgacaattgatgggatatattatgtt
gttgatcctggttttgcaaagcaaaatgtgtacaacccaaaacaaggcattgattcactg
atcatcactcccatctcgcaagcatcagccaagcagcgagctgggcgtgctgggcgtact
ggcccagggaagtgttaccgtctctacacagagagtgcctaccgcaatgaaatgtcaccc
accacagttcctgaaatccaaagaattaacctcgggatgacaacactaaatatgaaggcc
atggggattaatgacctcttgtcatttgattttatggacccgccatcacctcaagcactc
atatcttccatggaacaactatacagtcttggagcattggatgaagaggggcttctgacc
aaattgggtagaaaaatggctgaatttccactggaaccaccattatcaaaaatgcttctg
gccagtgtcgacctagggtgcagcgatgagattttgaccattatagcaatgattcagact
gggaatatcttctacaggccaagggagaagcaagcccaagcagatcagaaaagagccaag
ttctttcagccagaaggtgaccacttaacattacttgctgtatatgaggcttggaaggcc
aaaaatttttctgggccatggtgctttgagaacttcgtgcagtcacgttcccttcggagg
gcacaggatgtcagaaagcagcttcttactatcatggacaggtataaactggatgtcgtc
agtgccggtaaaaactttacaaagatacggaaggcaattactgcaggattcttcttccat
tctgctaggaaggacccccaggagggatatagaaccatagttgagaaccagccggtgtac
atccatccaagcagcgctttatttcagaggcagccagattgggtcatatatcatgagctg
gttatgacgacaaaagaatacatgagggaggtcacggtcatcgatcccaaatggttagta
gaattggcaccaagattttttaagtctgcagatcctacaaagttgagcaaaaggaagagg
caagagcgtatcgaaccactttatgacagataccatgaaccgaactcatggcgtttgagc
aaacgccgtgcttaa

DBGET integrated database retrieval system