KEGG   Peptoniphilus sp. ING2-D1G: ING2D1G_0590Help
Entry
ING2D1G_0590      CDS       T03807                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ped  Peptoniphilus sp. ING2-D1G
Pathway
ped00770  Pantothenate and CoA biosynthesis
ped01100  Metabolic pathways
Module
ped_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ped00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ING2D1G_0590
Enzymes [BR:ped01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ING2D1G_0590
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ING2D1G_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PrpR_N
Motif
Other DBs
NCBI-ProteinID: CDZ74752
UniProt: A0A090HX73
Position
I:595654..596844
Genome map
AA seq 396 aa AA seqDB search
MLRNKNILLAITGGIAAYKSPAIASILRKKQANVKTVMTSAACEFITPLTMQTMTSNVVH
VDMFNQLVDMDVEHVELAKWADIIVVAPATANTIAKFANGICDNLLTTVLMASRSKVIMA
PAMNTYMLKNAANIHNMDILKNRGVKILKTQSDLLACNDVGEGKMLEPEQIVEAIESELT
EKDLSGKRIVVTAGPTIEAIDPVRFLSNHSSGKMGYALSKRAKYRGAEVTLISGPTSIAP
PNVDNFIRITSTEDMFEAVKDNFDECDVLIKAAAPADFRPKNISEEKIKKEKNALNTIEL
EENIDIAKYFGSIKKNQIIVGFAAESIDEIEHGIEKLKKKNFDMIVINNIKQEGAGFKSD
TNIASIIDKNKNIEKLEKMDKEELANIILNKVVNLF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggaataaaaatattttattagcgattacagggggtatagcagcttataaatca
cctgctatagccagcatattaagaaaaaaacaagccaatgtcaaaaccgtaatgacatcg
gcggcctgtgaatttatcacaccattgactatgcaaaccatgacatcaaatgtggtgcat
gtagatatgtttaaccaattggtagacatggatgtggaacatgtggagttggcaaaatgg
gcagatattatagttgtggctcctgcaacggcaaatacaattgctaaatttgcaaatggg
atatgtgataatctgttgactacagttttaatggcgagcagatccaaggttataatggct
ccggcaatgaacacatatatgctaaagaacgctgcaaatatacataacatggatattctc
aaaaacagaggagttaaaattttaaaaactcaatctgatcttttagcgtgcaatgatgtc
ggagaaggtaaaatgcttgaaccggaacaaatcgtcgaagccattgaaagtgagcttaca
gaaaaagatttatcaggaaagagaatagttgtaaccgcaggaccgacaatagaggcaata
gatccggtgagatttttgtcaaatcactccagcggtaaaatgggatatgctctttcaaag
agagcaaaatacaggggtgctgaagtaacccttatatcaggacctacgagcatagcaccg
cctaatgtagataattttataagaatcaccagtaccgaggatatgtttgaagcggtaaag
gataactttgatgaatgcgacgtattgataaaagctgcggcgccggctgatttcagacct
aaaaacatatctgaagaaaagataaaaaaagaaaaaaatgcattaaatactatagaattg
gaagaaaatatagatatagcaaaatattttggctcaattaaaaaaaaccaaataatagtc
ggatttgcagctgaaagcatagacgaaattgaacacggaattgagaaattaaaaaagaaa
aatttcgacatgatagtcataaacaatataaagcaagagggagccggatttaaaagcgac
acaaatattgcaagcattatcgataaaaataaaaatatcgaaaagctggaaaaaatggat
aaagaagagcttgcaaacataattttaaataaggttgtaaatttattttaa

DBGET integrated database retrieval system