KEGG   Pseudomonas frederiksbergensis: PFAS1_28640
Entry
PFAS1_28640       CDS       T04786                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00626  Naphthalene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
pfk01220  Degradation of aromatic compounds
Module
pfk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PFAS1_28640
Enzymes [BR:pfk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     PFAS1_28640
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: APV43293
UniProt: A0A1P8F4A2
Position
unnamed:10626..11630
AA seq 334 aa
MSNKIMKTSRLTAEDINGAWTIMPTPSTPDASDWRSTATVDLEETARIVEELIAAGVNGI
LSMGTFGECATLTWDEKRDYVSTIVETIRGRVPYFCGTTALNTREVIRQTRELIDIGANG
TMLGVPMWVKMDLPTAVQFYRDVADAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLRLAPNIRFLPHEDDYYAAARINPERITAFWSSGAMCGPATAIMLRD
EVVRAKSTGDWAKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLKAGPC
RPPYNLVPEDYLAGAQKSGKAWAALHAKYSNELK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcgaataaaattatgaaaacgtcgcgtcttaccgccgaagatatcaacggcgcctgg
actataatgcccacaccctcgacgcctgatgcttctgattggcgcagcactgccaccgtg
gacttagaagagactgcccgcatagttgaagagctgattgcagctggtgtcaacggtatt
ctaagtatgggtacttttggtgagtgcgccacgttgacctgggatgaaaaacgtgattat
gtctcgacgattgtcgagaccattcgtggtcgcgtgccttatttctgtggcacgacagcc
ttaaatacccgagaagtcatccgccagacccgagagcttatcgatattggcgccaacggc
actatgctcggggtgccgatgtgggtgaagatggacctgcctacagcggttcagttctat
cgtgatgttgcagatgcggtaccagaggctgccattgcgatttacgccaaccccgaagca
ttcaagttcgacttccctcgcccattctgggcagagatgtccaaaattccgcaggtagtg
actgcgaagtatctaggcatcggaatgcttgacttggacctgagactggcacccaacatc
cgcttccttccccacgaagatgactattacgcggccgcacgcatcaatcccgagcgcata
accgcgttctggtcaagcggggccatgtgcggcccggctaccgccatcatgttgcgtgac
gaagtggtgcgggccaagagcaccggtgactgggccaaggccaaagccatctccgatgat
atgcgtgcagccgactcgacattgtttccgcgtggcgacttttcggagttctcgaagtat
aatatcgggcttgaaaaggcacggatggatgcggctggttggctcaaggctgggccctgc
cgtccgccctacaaccttgttccagaagactacctcgctggtgcacagaaatcaggcaag
gcttgggccgcgctgcacgctaaatacagtaatgaattgaagtag

DBGET integrated database retrieval system