KEGG   Pseudomonas protegens Pf-5: PFL_2717Help
Entry
PFL_2717          CDS       T00249                                 

Gene name
ghrB1
Definition
(GenBank) glyoxylate/hydroxypyruvate reductase B
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00030  Pentose phosphate pathway
pfl00480  Glutathione metabolism
pfl01100  Metabolic pathways
pfl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFL_2717 (ghrB1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFL_2717 (ghrB1)
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     PFL_2717 (ghrB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AAY91990
UniProt: Q5TM04
Position
complement(2998876..2999862)
Genome map
AA seq 328 aa AA seqDB search
MKKHLVLYKKLSPTLMARLQEQAQVTLIETLDAAGLNALRQALPSADGLLGASLRLDAEL
LDLAPRLRAVASVSVGVDNYDIDYLTQRRILLSNTPDVLTETTADTGFALILATARRVVE
LANLVRAGQWQRNIGPAHFGTDVHGKTLGIIGMGRIGEALAQRGHFGFGMPLIYHSTRPK
PAVEQRFNAQYRSLEQLLEEADFICLTLPLTERTQGLIGAREFALMRPESIFINISRGKV
VDEAALIEALQQRRIRGAGLDVFEREPLDHDSPLLQLPNVVATPHIGSATHETREAMARC
AVDNLLAALAGQRPPNLVNPAAWTSPRP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacctggtgctgtacaagaaactctccccaacgctgatggcccgcctgcag
gagcaggcgcaggtaaccctgatcgaaaccctcgacgcggcggggctgaatgccctgcgc
caggcgctgccgagcgccgacgggctgctgggcgccagcctgcgcctggacgccgaactg
ctggacctggcgccccggttgcgggcggtggccagcgtttcggtgggggtcgacaactat
gacatcgactacctgacccagcgccgcatcctgctcagcaacacccccgacgtgctcacc
gagaccaccgccgacaccggcttcgcgctgatcctggcgaccgcccggcgggtggtggaa
ctggccaacctggtgcgcgccgggcaatggcagcgcaacatcgggccggcgcactttggc
acggatgtccacggtaagaccctgggcatcatcggcatggggcgcatcggcgaagccctg
gcccagcgcgggcatttcggcttcggcatgccgctgatctaccacagcacccggcccaag
cccgcggtggagcaacgcttcaatgcccagtaccggagcctggagcaactgcttgaggaa
gccgacttcatctgcctgaccctgcccctgaccgaacgcacccagggcctgatcggcgcc
cgggagttcgccctgatgcgccccgaaagcatcttcatcaatatttcccggggcaaggtg
gtggatgaagcggcgctgatagaagccctgcaacaacggcggattcgcggcgccgggctg
gacgtcttcgagcgcgagccgctggaccacgactccccgctgctgcaactgcccaacgtc
gtggccaccccgcacatcggctcggccacccacgaaacccgcgaagccatggcccgctgc
gcggtggacaacctgctggcggccctggccggccagcgcccaccgaacctggtcaacccc
gcggcgtggaccagcccgcgcccctaa

DBGET integrated database retrieval system