KEGG   Polymorphum gilvum: SL003B_4082
Entry
SL003B_4082       CDS       T01458                                 

Definition
(GenBank) Dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00626  Naphthalene degradation
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    SL003B_4082
Enzymes [BR:pgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     SL003B_4082
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ADZ72499
UniProt: F2J6L6
Position
complement(4385967..4386962)
AA seq 331 aa
MKRDMLTVDDVTGCWAIMPTPSKPNASDPSATDTVDLDETARVAEALVAAGVDGILSLGT
LGECATTTWDEKQAYMRTLVETLRGRIPVFGGTTGLNTRDSIAMTRAAREIGVDGVMLGL
PMWVQPDVPTAVQFYRDVAAACPDVAICVYANPEAFKFEFPRAFWAQIAEIPQVVSAKYI
NIAALYTDLNLTRRRIRLMPLDVDYYAAARVDPEACSAFWTSGAVCGPAPAIQLRDLVLE
ARQSGDWSKAKALTDRIGMTYRTLFPNGSFKEFSVYNIGIEKARMDAAGWMTAGPVRPPY
HIVPEAILEGGRESGRQWAKLAAELEREAGR
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaagcgcgacatgctcaccgttgatgatgtaaccggatgctgggcgatcatgcccaca
ccttccaagccgaacgcctcggatccttcggccaccgacactgtcgacctggacgagact
gcgcgcgttgccgaagctctggtcgctgcgggggtcgatgggatcctgtcgcttggcacg
cttggcgaatgcgcgacgaccacttgggacgagaagcaggcgtacatgcggaccctcgtc
gagaccctgcgcggccggatcccggtctttggcggcacgaccggactgaacacccgcgat
tcgatcgcgatgacacgcgccgcgcgcgagatcggcgtcgatggtgtcatgctgggcctg
ccgatgtgggttcagcccgatgtgccgacggccgtccagttctaccgtgacgtcgcggcc
gcgtgtcccgatgttgcgatctgtgtctatgccaaccccgaggcgttcaagttcgaattc
ccgcgggccttctgggcacagatcgccgagatcccgcaggtcgtctcggccaagtatatc
aatatcgcagcgctctacaccgacctcaacctgacgcgccgccggatccgcctgatgccc
ttggatgtcgattattatgcggctgcgcgggtcgatcccgaagcgtgcagcgcattctgg
accagcggcgcggtctgtggcccggcgccagcgatccagctgcgtgacctggtgctggag
gcccggcagagcggcgactggtcgaaggccaaggcgctgaccgaccggatcggcatgacc
tatcggacgctgttcccgaacggctccttcaaggaattttcggtctataacatcgggatc
gaaaaggcgcgcatggatgccgccggctggatgaccgccgggcccgtccgtccgccctac
catatcgtccccgaggcgatcctcgagggtggtcgggaatccgggcggcaatgggcgaag
cttgcggccgagctcgagagggaggctggccgttga

DBGET integrated database retrieval system