KEGG   Pyrococcus horikoshii: PH0553
Entry
PH0553            CDS       T00014                                 
Symbol
PH0553
Name
(GenBank) 399aa long hypothetical protein
  KO
K07327  archaeal flagellar protein FlaD
Organism
pho  Pyrococcus horikoshii
Brite
KEGG Orthology (KO) [BR:pho00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pho02044]
    PH0553 (PH0553)
   02035 Bacterial motility proteins [BR:pho02035]
    PH0553 (PH0553)
Secretion system [BR:pho02044]
 Type II secretion system
  Archaeal flagellar protein
   PH0553 (PH0553)
Bacterial motility proteins [BR:pho02035]
 Flagellar system
  Archaeal flagellar assembly proteins
   PH0553 (PH0553)
SSDB
Motif
Pfam: Arch_fla_DE Baculo_PEP_C NPV_P10 DUF948 IFT57 FliD_C ApoLp-III Ribosomal_S15 Salt_tol_Pase GIT1_C Exonuc_VII_L PAX TadB_TadC_N PMC2NT
Other DBs
NCBI-ProteinID: BAA29642
UniProt: O58288
Position
493375..494574
AA seq 399 aa
MEMGYVTDAEINAKLAELKGKVPSVVINELREKLMAKKDTLTPKQLDEIIKRVLDAYGSQ
AAKYEQISKRVDELGKKLGELSSQLSRLVEALEEKKFAVHEKKAESIAEKAAEVTEKVER
IEELLEEKPKEEKSELAKKVEEIHKKVEELEEKLTGEKLEETKKKVEELEEKIEKGEEVT
AEEVGELAEKVEELEAEAAKPEEEVVVEVPEEEEKVEVVEEEVPPEEEEVVTPEVEVVEE
EKKEEVEEEKEKEEVGKMSEKMKIPEDIASILFEEEPKKARLEEIPEDVVSIMIALKWLG
FLIDRVGIQNLEKVLEFYYEIGWISEKVLNQLLRFARGTRPHHRDPEWKPAEKLTVQDHL
ISLLFIERLRGLRITRDVLDKLEREVKMLEKTLDEFYGV
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggagatgggctatgtaactgatgcagagataaatgcaaagcttgcagagcttaaggga
aaggttcccagcgtcgtcataaacgagctaagggaaaagctaatggccaagaaggatacg
ctaacgccaaagcaacttgacgagataataaagagggttcttgatgcttatggaagtcaa
gcggctaagtacgagcagataagtaagagggttgatgagctaggtaagaagttgggtgag
ttaagctcacagttatcgaggctcgtcgaggccctcgaggagaagaagttcgcagttcat
gagaagaaggccgagagcatagcggaaaaagcagctgaagtcaccgagaaggttgagagg
attgaggagttacttgaggagaagcccaaggaagagaagtcagagctggctaagaaggtt
gaggagatacacaagaaggttgaggagttagaggaaaagctaaccggtgaaaagttggag
gagactaagaagaaggttgaggagttggaggagaagattgagaagggagaagaggttacc
gctgaggaagttggtgaattagctgaaaaggttgaggagttggaagctgaagctgctaag
cccgaagaagaggttgttgttgaagttcccgaagaggaggaaaaggttgaggttgttgag
gaggaagttcctcctgaagaggaagaagttgtaacccctgaagttgaggttgttgaggag
gaaaagaaggaggaagtggaagaggaaaaggagaaggaggaggtgggtaaaatgtccgaa
aagatgaagatcccagaggacatcgcgagcatcctattcgaggaagagccaaagaaggct
aggctcgaggaaatacctgaggacgtggtgtccataatgatagccctcaagtggcttggc
ttcctaatcgacagggtgggaatacagaacctagagaaagtccttgagttctactacgag
atcggctggataagcgaaaaggttctcaaccagctcctcagatttgccaggggaactagg
cctcaccacagggatcccgaatggaagcctgctgagaagttaaccgtccaagatcacctg
ataagcctcctcttcatagagaggcttaggggcctaaggatcacgagggatgtactagat
aagcttgaaagggaggtgaagatgctagagaagaccctcgatgagttctatggagtctag

DBGET integrated database retrieval system