KEGG   Pangasianodon hypophthalmus (striped catfish): 113525688Help
Entry
113525688         CDS       T05759                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113525688
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phyp04131]
    113525688
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:phyp04812]
    113525688
   04147 Exosome [BR:phyp04147]
    113525688
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113525688
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   113525688
Membrane trafficking [BR:phyp04131]
 Others
  Actin-binding proteins
   Others
    113525688
Cytoskeleton proteins [BR:phyp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     113525688
Exosome [BR:phyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113525688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase C1-set Ig_6 Pkinase_Tyr Ig_5 THB Titin_Z Ig_4 DoxA
Motif
Other DBs
NCBI-GeneID: 113525688
NCBI-ProteinID: XP_026768075
Position
Unknown
AA seq 31561 aa AA seqDB search
MTTQAPTFTQPLQSVVALEGSAATFEAQVSGNPVPEVSWFRDGQVLSAAALPGAQISFSE
GRAVLRIPAVTAAHSGRFSVRATNGAGQATSTAELLVTAETAPPNFIQRLQSMTVRQGSK
VRLDVRVTGIPTPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSATN
SSGRATSTAELLVQGEEEAVPAKKIKTVISSSQISQARQTRMEKRMEGRFEAASMQMQME
GDILVQQMAHKTPPRVPPKPTSRSPPSLVTKVSATRQQSPSPVRHVKAPTPTPVRTVSPS
TRLSISPIRPVKSPVMTRKQVTTSTEVLPPWKQAGYVSESSYVASMAARAAQVQTTTQVR
MEQRWEGSIAMQQQVSGVAVKEEQQSMDDKSVAVATVVAAVDQARSRKPFAGSAEPHGVD
STTATVLPAPPTEQIKHISSMTLLEQASEREAIGSLPEHTTTMETTSSHYTFASQEQGAE
KKAGAVAKVLAAVDQARVRKPVHVESALAEEEMDIKQQAMLSAKQQAASKVELLQIPSDI
PSTSTEQTVHVSQIQRTTEVKAQVDTGLAPSPVPHFTVSKVTVPKPDHSYEVSIAGSAIA
TLQKELSSTHTAQKIIKPVKPPTYKIVETRVTPEPTPPPFRDATEKYQLHFDTELQRQIG
ASYTGEWETQVLETAAVPSAAKEPSIPPTVVAGLKNLTVTEGESVTLECQISGHPTPGIM
WFREDYRIESSIDFQITYEQGYARLVIREAFAEDSGRFTCTATNEAGTISTSCYLLVKVS
EEIETRAEITMEKQAVIETKEVATSEVRVVSETVEAGAAAAAFFVRKPVSQKLVEGGSVV
FVCQVGGSPKPHICWKKNGVPLTSGYRYRVSYNKDTGECKLEISMTFADDAGEYTITAKN
QHGEVSTSTRLLEEEEYEAYMKTLDVTYKTEVITTVVQEPKVADLPPVVISEYDMQRRMA
QQAQMMTFISEREFQISAIEQRIIQEIEIRILKITYRELVIEDGEEMLLSAAEHEAIGSS
FSTPVKSYRIMEGMGVTFHCKVEGNPLPKIAWYKDGKRIKHGGRYQMEVLQDGRATLRLP
VVLPEDEGVYTALASNMKGNAVSSGKLYVESTAAAQPFYPQTEAMKRVQSESPMSARSIS
LSPGRSPARSVSRSPARRLDETDETQLERLYKPVFVMKPSSFRCAEGQTARFDLKVVGRP
MPDTFWFHNGQQVVNDYTHKIVVKEDGTQSMIVVPAMPHDSGEWTVVAQNRAGKTTVSMT
LTVEAKENLIRPQFIEKLKNVSVKEGTLVELAVKAIGNPLPDIVWLKNSDIVSPHKYPNI
KIEGTKGEARFRIPQTAGSDSAWYTATAINKAGRDTTRCRVNVEVEFVEPEPERRLIIPK
GTYKAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPHFKKKLTSVRLKRFGPVHFEC
RLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVITCRATNKFG
VDQTSATLIVKDEKSLVEESQLPEGRRGPRLDELERIAHEGAPAGVTGDEITEKTKPEIV
LLPEPIRVLEGETAKFRCRVTGYPTPKVNWYLNGQLIRKSKRFRLLYDGIHYLEIVDCKS
YDSGDVKVLAENPEGTAENTVKLEIKQKEDFRSILRRAPEIKAPEGPGPEHGRVSFDVVK
VDKPAEPSQAKEVIKLRRAERVVHEKPTEETEELRSKFKRRTEEGYYEAISSVEFKSRKK
DESYEDMLKKRKEELLHWTKEIPESEKKKIEEERKLTIPTIKPEKITLSPSMEAPKILER
IQSQTVTLGEEVRFRCRVVGKPDPECQWFKNGILLEKSDRIYWYWPEDHVCELVVRDVSA
EDSASIMVKAVNIAGETSSHAFLLVQAKQVITFTQQIEDLHAKEKDNMVTFECETNEPFI
KVKWLKNNVEIFSGEKYRMHSDRKVHFLSVLIISMDDDAEYTCAVVEDDHIRTSARLHVE
GAPLEIVKNLESIEVPESYAGEFECEVSREDAEGTWYFENKEITPGMKHVMSSRRGRHSL
CVKDVKKEDQGKYTFKMGDLKTSATLKMKLRPVTLMQGLSDLTVCESDIAQMEVRFSQEN
VEGTWLKNGQPISPTDRIHIVIDKLVHKLLIENVTKDDAGTYSFNVPAHLISTTGKLTVQ
TIGIVTPLKDVSTIEGTKAVLEAKISAADVSSVKWYHNDKLLTASDRVQVVTKGSKQRLV
LNRAYASDEGQYKLVVGRVESSCKLTVQKISIVKHMEDRVCTETQNVTFEVELSHPGIDA
LWTFKGQPLKAGPKYKIDSKGTKYSLIVLNAMKDEEGPYVFAAGEKTSSAKLTVSGGAIN
KPLQDVTVAESQTAVLECEVASASAEGKWLKDGHPVDFSDNVRSEQIGAVRRLVIVISRP
QDIGEYTYQVANSKTSANLRVEAVKVKKTLKNQTVIETQEAVFSIELTHLDVKGSQWIKN
GVELLPSDKYEITVEGMVHTLKIKNCNTQDESVYGFKLGKLTANARLNVETIKIVKKPKD
VTSLLNSTASFELSVSHDNVPIKWMFKNQELKPSANIQILSERKAHKLVISNVEENMEGE
YTAIVGHVQCSAFLHVESLRVTKPMKNIEIPETQVATFECEVSHFNVPSTWLKNGVEIEM
SEKFRIVVQGKLHQLKIMNTSRDDTAEYTFVCGNDRVSATLTVTPILITSMLKDLNAQEK
DTITFEVTVNYEGITYKWLKNGVEIRSTDRCQTRSRQFTHSLTIRNVHFGDSAEYKFVAG
SAETSAKLFVEARVIEFTKHIKDIKVTEKKKAIFECELSEPNVQVTWMKNGQELEISERF
KVSTDKYIQRLMIQTVRMSDAGEYSVVAGSSMSKAHLTVEGKDVRITEPVEKEITVLEKQ
RATLEFEVNEDDIEGRWLRNGVEIQFTLDKRYSYVTIRKIHRLTITETWRSDAGEYTFIA
GKNRSVVTLHVNIPEPPQIIRHMEPLSVEAGKPARFSVEVTGIPQPQVSWYKNSQALSPG
FKCKFLREANEHTLLLIEVFPEDAALYTCEARNDYGQATSSASLNVEVPEVVSPDTGAPL
SPPVIISPIQHTSATEGGSARFQCRVSGEDLTITWFCKDQEIKQSNFFRMSQFDDSCQLE
IARVYPEDEGEYTCVARNSAGMVSCSAVLKLEGKTQIIDITSQESQWHALSSLSTSIKSV
KKEPVGQKPTFIQPLVSCTVPHGEVARFYACVSGIPKPEISWFHGQEPVKSNKNIVFHFD
EMTSTATLIIVDAFSEHAGQYTCKATNSAGEAVCTATLTVPTEVTKREDIETKIEEVVKE
YSSLTWKTDEEEEEETFSTSLQLPETAKTLELKPEQKHYSSSFEKKKKAPDFITKLTPSV
VTVGSSARFTVTVSGFPKPKVQWFHNGKSITSSSVHKFVEERNEYSLIISEVKKEFEGEY
SCTASNRFGQTTCTTTLKVEISDLSPAEKWVEKMFKIAGEPPCFTTQIQSVQCAEGCEAK
FQYKVTGNPHPEVQWFKGSYQIKPSPNCCVVTDPDGTGFLIMIDAQQKDSGLYTCRASNC
FGEATCSAELVVFRKSFSVSHQQQLARGQKAYKVSTTEEATESRLYSVSLPIQARTRVQE
GHQMIYTIGTEDKHTIASEQVGTFCEIDVSAATMHKEQVTHQAAVLQSHKMQERVTVTPI
QPQSAVATPLKQLHMAAMTSAVQENQGFTEQHFDRIKSPEVTELEIAMEQPSKCMSAITE
SVTPLTIVKAEPLARQEEKQLKATPEPKHQMLSHQVETALAIVKEQSQIIPQTEAEKSYQ
VKEGIKILYSAVSTEKQQLTEGHATDISVLDSAIRSSVKTESSKPVILSVSETKQMLSKE
EKFSMQRTNEETASLAKDRVLRSALVAEETNELKADITSIIPGLDSAVSVHTQSEEEQVF
NLQIFTDQTVLPSEGRFSSERPSPEQAEVRKSPTLMQTVSTDDQGTVTCEESTQLSVQET
AISIVPRKEVPAPLHLQAIHPDNMLSKEGILSAEQPDQQMAVLRQERARKHAVTTEEKRE
LTADYSRALDVSVSGFQSEIRKEPKPQNILQVFTEAMQLPKEKPFASDIKQQRALVQKED
HWNVLHAMSVSDRKDLDEGHTENLGAAEQYTCLTKMEPKISSEFVHVEEKAISTESTISL
EAAEQDFAVQIQEGQSIRQSILMEEKHVIRGEVSQNITKSETTIAVASQQQMGALLVSES
RESQVLPKELTFVISAPKAHSLDIKHQLKNMLSSAVARDQPLILADVVERLEVVEVQEVK
VQKEPKYIIFTYLITTAGAPIEITIAFEGEYPQTADLKSELQAAFYSIIFREHQVLTSEQ
PGTMQIDRPQRSQVSRATSKERISPMVETVRLTENAEGFLPPKTQSAALKTEGAATFQSV
SFQKETIVEDSRSRMMQMSKESKMELKQSVHTEKQEIRSVTVESQERDVGAGDITTSVSF
GQVPVEQPADVFVRSEGLQKYLMEETIILQEETVRDDHSVFESTLEDITLDEYSKATFSV
TIRNVSKVNWLFNGKQIKSGKEFKCSKDRDTYTLVIDNVIKKKHEGEFTCEAVSEAGTTR
TSSRLTVVTRVPPVFRHKIHALETNVGSPAKFECEIEDAPNVTFKWFKSGSEIRQSDKYK
IISHSTTSSLELLSPTQADSGEYMCRALNQHGSDSCSANLTVTEVFPPEFVSKPEPMTLF
VGKQAKFQCVITGSAPMNVVWYKDNIAILPDEHYNVSFEKNKHCLEIMKLEQNDQGTYLC
KASNSVGMATCCTEMRVIDKPSFVKTFESTSVAVGNPLRLECQVNEDTGVTITWTRDGKK
IHNTMDSKISFDEKVVSLDIPKTKIKDTGTYVCTATNDAGSSSCSSVVTVKEPPVFVKKL
EPKILWKQGISARLLCAVKGSPELHVSWFLNDKQLSSSERHKIIFKDGQATLEIIDLTVS
DSGNYTCEVMNEAGCESCSTNLTVKEPPAFKKELEMVEVVKGYAAKFQCEVTGTAPFDVT
WFKDKKPVTIDKKHNIVTKDTISYLEIHSFDSADVGDYQCVVSNDVGKITSKSVAKLKDP
PSFVKRIENTTAVLGSAVKLQGALKGSAPITVTWLKDSELLRQDDPNITMTFENNIASLA
IAQIAMNHDGKYTCQAENEAGQQKSEAKLSVQEPARIVDKAPSISVTAGDSATLECTVSG
SPDLKVKWLRDGKEVIGGRKYKISFKENVASLKILSAERGDSCEYTVEVSNRVGKDHCSC
SVTVLDKIIPPTFTKSLKKVDGNLGGNIQMECKVSGSQPMTISWFKDGKEITTGIKYQTE
LKESTALLKIFQLETADAGVFTCHATNAAGHSETSGTVSVKEPPVFTLKPESQDAIPGSN
VVLKAAFIGTPSFTIKWFKEEKEIFTGDTCFIKKDASSSTLALHSVKPSHSARYTCQVAN
DAGSVSCTAVLFVKEPPKFVTKLDSTKLAVNGSVVVLECEVTGSPEISITWYKNNIEISP
SNKYQMTFTDSVATLQISNCSFEESGDYICVASSDAGSDKCSCLVTVKEPPAFIKLFESR
EVVKGSDVVLEGSVSGTPPFEVSCFKDSKQIRNDRRHIIGIKNDVVTIEILKFEPGDAGK
YKCTVANEVGQTSCDCEIILKEPPSFTQKLDNMDALLGTELKMLCVLKGSLPMTVSWTKG
DHEVRDTEDVQISFENRTAVLHFSNVKLKHSGKYTCHAQNEAGSQKCTAALVVKEPANIT
EQAKSISVTVGDPATLECRFSGTKSLKVKWLKDGKELTSGKKYKIQSTDTSSILKILSAE
RNDEGEYTFEVSNDVGSSICEASVTVLDQIIQPSFTRKLKQLESIKGSFAHLECLIAGSL
PITVTWFKDNKEIDTNEKHKSVFFENAASLEISRLDSSDSGNYTCIATNKAGSAQCSAVL
KVKEPPVIIEKPESQQVIPGTRVKFSVLVSGTPPLTIKWFRNRKEVLSGVDCSIQKDDSS
SSLELFFTKPSDSGDYICEISNDVGSDSCQTTLFVKEPPKFIRKPDKVSVVKPGQSVIFE
CEIVGTPEIDTYWFKDGNDLSPDDKHKMSFVNSLARLEITGADLKDSGVYYCEARNEAGS
ESCSMDLKVKEPPVIVKPFTPVEVVKGLNASFECQIRGTAPFKITWQKDSKEIMPSTKHV
FSQKNGSLMLLDIQKCDDLDVGEYQCIISNEAGSCSCRATLSIKEPPSFVEKIQNVTTVL
GNVAEFKCVVKGSPPLNIQWQKDETWILEDAEIVRTFENNVATLRIPKCQSNHSGRYTCQ
AMNEAGQEKCFATLLVQEPPQIIEKPEIINVTAGDPVSFECKVTGTAELKVKWSKDGKEV
VPSRQHSLSFVNNISNLKIQSAQLDDGGTYLFEVSNYISTCKCKVTLNVLEQIIPPAFIK
PLTDMEEILSSPVKLACNISGSLPISVEWFKDGTKLTGKTKHKLVQDHHSVSLEIERLEK
ADTGTYSCKLTNKAGSCECSGTLRVKEPPSFVVVPEPQAVIPNTTVRFKSTFKGTPPFMV
KWFKEDTELITGPSCFIGLEGLSSFIDLYAVGLSNTGPYSCQVSNDAGTAKCTTSLLVKE
PPEFVQKLPATKFLKMGLPLRLECKVTGTPPLKISWYKNDNAVIESNNMMMAFDGSMAVL
EILSTSCDDDGVYTCEVQNDAGTKSCSTTLSVKEPPVFQKVPSPAEGLKGKDVSLSCELK
GHAPFEITWFKDQKQLKESRKYKFVSEGHFATLHILGLEASDAGEYECKASNNAGSDACQ
GLVKLREPPVFVKKLTNMTVIAGEEVTLVATVKGSEPISVSWVQDKDHVLRDGDNRKITF
ENNQISLRIFKADSTTAGKYTCEIKNDAGVAQCMANLTVLEPAAILDRTESVSVTTGDPA
VLECTVSGTPELKPKWYKDGMELSSGQKYKITFSKKISSLKVLSTDKGDTGEYTFEVSNE
VGSDSCKMHLGVLDKIIPPTFSRKLKDMHSIVDKPIELDCKVSGSEPLTISWYHNGEEIE
SGPNYEISFAENTCTLKLPILKLSDAGSYMCKAVNSAGTAETTALLDVKEPPSFVTPPQP
VEALPGSNVTFTATVRGSAPLRLKWFRGSTEIVSSRACEIALRGDIATLELFKIDKSHAG
EYTCQIINDVGKENFPVTLFVKEAARFVKKLKNISVEVGKSMVLECTYAGSPKILVKWHK
DGQEIFSSYRYNITTTESSCILECLNCDKEAGGKYSCDVSNEAGHDTCDATVSILEPPFF
IESLEPMEVTAGDAVCLKCQIGGTPDIKVSWFKGDGKVRSSPTCRIEYSKGVACLKLAKT
SKADIGEYTCTAENSIGSASSSCHLTVQEAKTPPSFPKKITSIQQTVGHSVQFECRVAGS
SPLEISWLKDGEVLKSSSEYTMTFDDNSAVLRIAQGEMRHSGEYTCVATNIVGTASCRAK
LTLQEPRYPPVFDRKLSPVDVSVGNTVQLECHMTGSLPIKVTWSKDHKDIRSGGNYKISC
VENTPQLTILKADKADSGLYSCHASNDMGKDSCSTEVTVKEQKIPPSFTKKPSATLEETE
GKLLKIEARVAGSLPMIVNWYKDDKEIFSSDRYDITFRSNMAVMVIKSSSSSDSGTYTCK
VTNEAGSASCQVLAHITERKVPPNFDLPLKPVTLNEGETLSLSCHVRGSPPLKIQWMKDR
RELMSSASTKITFVDGTATLEMLNVSKTDAGDYLCKATNEAGSEFCKSRVTIKEKPKAPA
AAPTPAPAVPAAPEPVKKLDNLFFIEEPKSVHITEKGTATFIAKVGGDPIPNVKWMKGKW
RQMTHGGRIAIVQKDQDAKMEIRNVTKSDAGQYRCVASNKHGEIESSTDLTVDERKEITP
EMVTLKKTPSKQKSPKEDKDIDIVELLRNVDPKEYEKYARMYGITDYRGLLQAIELLKKE
KEEEQSARPELEHTRRESEEEDLSKLVADLQKRMEQTEPVTLIRDITDQTIVANREAVFE
CEIKINYPEITLSWYKGTQKLDTSDKYEIKVVGDRHILKIKNCQTRDEGSYRVVCGPHIS
SAKLTVLEGEVEQHMEDVAGKEGQTCTLTCQFSIPNAKAQWFKNGKLLEPHGRFTYSVAN
YTQKLSIKDVRPEDQGEYTCKYKNLETTANLWVEAEQIHFTKRIQNIVVRERQSATFECE
VSFDNAIVTWYKDIWELKESPKYTFRSEGRRHFMIIRNVTSADEGVYSVIVRLEPRGEAK
STAELYLSGKDIDVGRVPYDIPDSSIQVPEAPSAFTVEAESSVEYYQYEEKMEIQEYEYR
AEERIVEEISVTAPRIPVEEIVERKALGVREEVPTKVPEMVEKPEEKRTPVEEKIEAPVK
VPEAKKPKEEKVIPLKVEEPKVLPTKEEREVVPAPQPTKVAPEKVPEAVAPVVSKPKPKE
PTPKPPSVPETIPEPMLKAKPEPTPEKKLETKPELKPVPLKEIEPTPAKVPLELKKPKPT
EPEPPRAVPTKPEPAQVTVVPKDIVPQKVQEPSKKPEVPSYIPAEKEEVQEEIALFRKEI
THIPKVEEDKEERKKKAVPDRKDVTPVPQISKPKVTPVTESMLEAKPELKTERKPEFKPE
PKLDVKPEPKPKVKPEPKPEVKPEPKPKVMPEPKPEIKPEPKPEVKPEPKPEVKPEPKPE
VKPEPKPKVKPEPKPEVKPEPKPKVKPEPKPEIKPEPKPEVKPEPKPKFKPEPKPEIKPE
PKPEVKPEPKPEVKPELKPEVKLEPKPKVMFEPKPEIKPEPKPEVKPEPKPGVKPEPKPE
VKPEPKPAVKPLPKPEVKPEKPAPEKKPESLLPKVHVEEEKPKPTHREPAQAVPTKPKPA
TVVPKEISLQKVPEPEKKAPSEKPAIPLKKEDVAPKVEKKPTPEPAKKISPVEVKKEAPP
EPAVVLEAKKVPPVEVQEKRKKAEDLKTMEKITETPVPTPPEPSISKPTAKEDQIHHDQQ
PKDGEKEPVAAPAPTPVKKGKILITEEEKLEMPTLKKVTRISKDKHEEQETVKLKKVYKP
SPEEHEEIKKVYAEAATEILITESYEAERQFEKYERIKRTEIIRPEKDKITSVEPDEEPE
KTKTEEEKVEKPDLKKIAKIPKQDVPEEPDLALKKIKKLLPETKEQETVKLKPFEKPGKP
VPEPAKDTKIEPTEKEPVSFQKGREPISFEKAEKPQKADEQKEPEVTKKTTEPPKPDKKM
PDEAVHKPVDRAKKDEQAKEPDTPLWKGKRIPKQDEEPEKVQLKPFTKKPSAGSPEEKEA
PEPKERQPIEISPPSRMSKTELLKEPKTPQKEVEIPEKEVEKKPSVVPKEEEKKEFPKKV
TPVKKEVTPKKEDEKKPLVIKKGSLPKEPEKEEVILKPIELAKKGLEPKKSPSPKVTQAE
PTELAPLERKPSVGVAKKPLPEKVSPKESIESVILKKVPKKISPQEKKIEEIPTVPKKIS
PQEKKIEEIPAVPKKISPQEKKIEEIPAVKGSEEIPLIKELSPGVVELRKISTQMEEEAF
EEEMAEVGDEEEDEAWGWELSPQDSYASEDTEYLEEGALETAGIPGGRREGKPKEEAARG
RGLKPKQTPSPGDAGRGRGLKPGAGGDKPPGQSPFEYTLKAVPLKFVKELKDIVLQEAES
IGSSAVFECQISPSTAVTTWMKDGSNLREGPKYKFTSDGKDRKLAIVDVQLSDTGEYTCV
GKLGNKEKTSTAKLIVEELPVRFTKNLEEDVAVIKGQPMYLTCELSKDRDVIWKKNGEPL
SEIAGKIAINVIGLQRAVTIQDANDDDAGVYTCECENLKTQSNVKIIEVIRDWLVKPLRD
QHVKPKATATFKCELFKDTPNWKWFKGNEEIPNEPTDKTEVKKEGKDITLTIKNAQPNDA
DEYAIEVEGRRYTAKLTLGEREAEILKPLASVEVVEKEEANFDTEISEDDVPGEWKLKGQ
VLTRSPTCDIRAEGKKRFLTLKNVQLDQAGEVTYQALNAITCAMLTVKEIEMDFIVPLKD
VTVPEKKQAKFECTITKDVSKVMWYRGSDIISSDQKYDIIDDGKKHMLVINHCEFDDEGD
YSIEVLSKTSKAKLTVEGIRLKFISPMSDQTVKEGKTAWFEIELSHENVPVTWYKNEIKL
HPSRTVLTHVDGKKHILEIKEVTLDDTCQITAEAKGISTTANLTVLEGDAYFTVKLQDYT
AVEKDEVTLDCELSKDVPVKWFHNEIEIKASKMVSMKVEGNRRILHIKKVENKDKGQYVC
DCGTDKTMATVNIEARDIKVVRPMYGVELYDGETARFEVELSEDDVHGQWKLKGDVLSQS
PDVEIIEDGAKHTLTLYNCKVPQSGEVSFQGANAKCSANLKVKELPITFLTPLSDVQVYE
KDEARFECEISREPKVFRWLKGTQELKADDKFDILTEGKRHTLVVKSAAYEDEAKYMFEA
EDKRTSAKLIIQGIRLEFIKPIKDVTVKERETAEFSIELSHEKVQVTWYKNDVRLHPSKV
VHMSEHGKIHTLSFKEVSIDDTSLIKAEALGKSCEAMLTVLEGEAYFTTKLQDYTAVEKD
EVVLICELSKPSAEVKWFKDGKEITPSKNILIKADGKKRILTVKRADKGNIGQYTCDCGT
DKTTAKLNIEDRDIKVVRPLYSVEVIETETAHFETEISEEDVHGNWKLKGEALHQSPDCD
IKEEGTRHMLILYNVRKDMAGGVDFSAANAKSSAQLRVKARVIGLMRPLRDVTVTAGETA
TFDCELSYEGISVEWFLGGTKLEPSDRVVTRAEGRTHTLTLRNVKLTEAGEVKLTAKDFQ
IQANLIVKEPPVEFTKPLEDQTVEEEATAILECEVSKENAEVRWFRDGQEIRKTKKYEMV
ADGRKRKLIIQDCTLDDSKTYTCDAKDFKTSAFLNVEPPHVEFTKPLHDVEVMEKETAKF
ECEVSRENAKVRWFKDGNEIRKGKKYDIISKGVQRILIISKAVFDDEAEYECDARTSKTS
GMLTVVEEEARFTKNLANVEGTETDSIKLICEVSKSSAEVTWYKGDQELPEGGRYEHVAD
GRKRILIIQALHMNDAGEYHCKLPRSQTTGNLRINELAAEFISRPQSQEVVEGEKAEFVC
SVSKDSYEVKWLRGDKELQTDDKYEITSEGKRRGLVVKKCELSDEGPFVALIGATRASAD
LIVLEKLRIITPLKDTKASEGQEIVLNCEVNTEEAKAKWMKNDETIFDSSKFIMTQKYNV
YSLRIKDADMSDAATYTITLTNQRNECVKSSAKITVQEEDLKIIVPLEDVETQEKKTISF
SCKVNKLNVTVQWMKAGQEITLSKRVVYRVDKDKHTLTIKDCSLADEGEYFVIAGADKSS
AELIISEAPTDFIIQLQDQTITEFEDAEFTCQLSKEKAEIKWYRDGREIREGPRYQFDRD
GKTCTLRIKECRLDDECEYACGVDDKKSRARLFVEETPVEIIRPPNDIFEPPGSDVVYEV
ELNKDRVEVKWLRNNMTIVQGDKYQMMSEGKIHRLQVCEIRPRDQGEYRVIAKDKDAKAK
LELAAVPKIKTMDQELVTDAGKPFVMSVPYNAYPHAEAEWFFDNISLPKENLHTMPDKAE
YRLKDPKKSDEGRYKIVIKNKHGEGEAFINLKVIDVPGPVKNLHVVDTADGEVSIAWDEP
ESDGGSKILAYVVERRDVKRKTWTLATDSADTTEYTVTGLQKDSKYFFRVCARNRVGSGP
NVETDEAVQAKNKFDVPDAPQNVTVGNVNKFGATVSWEPPLFDGGSEITSYIIELRDRTS
VKWSPVMVTKAQDRSAIINDVIENKEYIFRVRAENKAGPGKPSAATNPVKIMDPIERPSP
PLNLTHSEQTKDACLLTWETPLRNGGSMITGYIIERCEEDSDKWLRCNARLCQDLSYRMS
GLKFGKNYKYRVIAENAAGQSDPSNTVGPVLADDPHFAPTLDLSAFKDGLEVIVPQPLTI
RVPITGYPTPTAKWTFGDKELTSGDRVSMVTKSTFTELVITPSVRPDKGTYSLTLENDVS
SVSGEIDVNVIACPSAPKDFKVAEVTRKHVHLMWDPPDHDGGSPLTGYQVEKRDVSRKTW
VKVISGVQDQEYTITDVIEGKEYLFRVIACNKCGPGEPAYIDEPVNVSSPATVPDPPENL
KWRDKTSSKIFLSWEPPKWDGGAPIKGYTVDKCQRGTDKWEPCGDPTPELKLEVTGLIEG
QWYAYRVRALNRLGSGRPSKATDEILAVDPKEPPEIHLDAKLLAGLTAKAGSKIELPADI
TGKPEPKVKWTKADLILKEDDRISIDSKPGHSTVSIAKTKRDDSATYIIEAVNSMGRATA
TVDVNILDKPGPPASFDISEITNESCLLAWNPPRDDGGSKVTNYIVERRATDSEIWYKLS
STVKQTNYKATKLVTLKEYIFRVYAENQFGIGPPAEHAPIIARYPFDPPGPPYKLEASDI
AKDAVTLTWYEPDEDGGSPITGYWVERFEPDVDKWIRCNKMPVRDTNLRVKGLPTRKKYK
FRVLAENLAGLGKPSKETDHIMIKDPIDPPWPPGKPSVKDVAKTSAFLQWTKPEHDGGAK
IESYIIELLKSGTDEWVRVADGIPSVEYFLKGLMEKQEYSFRVRAVNAAGESEPSEPSNP
VLCKERLNPPSPPRWLEVVSISRNNAELKWTAPERDGGSPITNYIVEKRDVRRKGWQAVD
TTVKELNYTVTPLNEGSLYVFRVAAENAVGPSEYCELVDSVLAKDTFTTPGPPYALTVTD
VSKTHVDLKWEAPKNDGGRPILRYVIEKKEKLGTRWVKSGKTSGPDCKYRVTDVIEGTEV
QFQVLAENEAGVGHPSEPTDIVVIEDPTGPPSPPQDLHVTEAARDHISIAWKAPERNGGS
PVTGYHIELCEAGTEKWMRVNSRPVKELKYKAGEEEGIVPEKKYIFRVRAVNSIGASEPS
DISESVYAKDSDCNPTIEFQTKDVVAVEGERMHLPIPFRAVPSPRITWHKDGKEMKADER
ISFRSDYTSCHLEIPSCLHADAGQYKVTLENSLGAISGTINVKVIGLPGPCKEIVASDIT
KNSCKVTWEPPDYDGGSPILHYVLQRREAGRRTYINVMSGENKLSWPVKDLIQNGEYYFR
VGAVNKIGGGEFIELRNPVIAEDQKHPPDPPVDVETHNPTSESVTLTWKPPMYDGGCKIM
GYILEKKMKGEEKFERCNDFLVPVLSYTVKGLRPGKEYQFQVRAENAAGISEPSRNTPMV
KATDAVDRPKVFLSGSLQSGLSVKRGDEIRLTAYISGFPYPEITWMRNKSTIRPEALKKR
PEKPVRKKKEKKAEEAKIEEDKEKKEEMKKEEQDKKEEEKKEKLKEVEEPEEPEEEYHPS
LNERLSIDNSRKGESSILVKDTIRGDHGVFTIKVENDHGVASATCEVIVLDTPGPPVNFR
FEEVRKDSILCKWEPPLDDGGSEVLNYVLEKKDNSKADTGWVTVTSTLRGCKYPVTKLIE
GKEYIFRVTAENRFGPGKPYISKPVIAKNPFDPPEAPEKPEIMDITANSMVVTWNEPNDN
GSPIQGYWVEKREINSTHWARVNRNIIDALEVKVEGLLEGLTYIFRVCAENVAGCGKFSP
PSDPKTAQAPILPPGPPIPRIVDTTDHSIIVEWDPPADNGGADIFGYHVDKVIAGTKDWS
RATERPWKNHTFTVYGVREGAKYIVRVVAVNSAGEGAPGMTDAVIVRNPAEMPVIELDIS
VKNGLVVRAGEMLKIPAHVMGKPKPSLTWTKDDVAPDKERVEIEEVGQDSTVIIKTSKRS
DSGKYQITAANPSGIKSAWTRVEVVDVPGPVLDLKPVVVTRKLMILNWSDPDDDGGSDLT
GFTVERREPKMHTWRQPIETAASKCEIVGIIEGQEYIFRVVAKNKYGCGPPVDLGPIRAV
DPQGPPSSPEKFHYTERTKSSITLTWKPPRNDGGSPIIGYIIEKKRQDQPAFQPVSKDLC
TALTLTVENLDELHMYEFRAKAVNCIAESDPSIPLTVVIQDDEVPPTLHMMKHFKGDLIR
VRKNEPVEIPAEITGLPMPKVEWLKDDVVIVKPTERILFETKVIDRLTEHTKLTIPAIAR
LEKGTYTVSASNRLGSASHSITVEVLDRPTPPRNVAVSNIRATSCQLTWDAPLDTGGSEL
TNYIVEKKDLNVEDVEKAEWVQVTNTIIEKKYGAWDLVTGGNYMFRVKAENKYGISDGCE
TEEVQIKDPFALPGPPEKVAIAEHSKAHMLVTWEPPMDCGGSMINGYWLEKREKGTTYWA
KVNKTLVSKRGMKGWEFLVTRLIEGTEYEFRVMACNAAGVGPPSAVSESAFAIDPLAPPG
MPAAPVVADKTKRSVTLSWTPPAKDGGSPIKGYIIEIQDEGTSDWARVNDADNLHPTTEF
TVPNLQELKKYRFRIIAVNDNGESEPSPRTTEVLMEDIHTEPKIFMDISADELLCIRAGS
PIKIPVTITGRPVPKVTWEFDGKAKTEKKDRLHILPVDSQVESTDTTSVVTIPVSLRAHS
GRYTVTAKNKTGQKHINIRVIVLDVPGAPKDLKVTDITRSTMRIIWKLPDTDGGERIKSY
FIEKKAVSGKAWTTVNAACANMAFVVPDLLEGQEYLFRVRAENRLGMGPFTETTEPARAR
DPIYPPDPPTKVKINLVTKNTVTLTWMPPKNNGGAPVTHYIIERLSWDTSGPQKETWKQC
NKRDVEETTFIVEDLKEGGEYEFRVKAVNEAGPSRPSGTVGPIIIKDQTCAPIIDLRESL
ESAETFDVNILARIQGCPFPSLVWQKATSDKPDEKFDVQYDQHINKLVSDDKCSLVIQQS
KRDDSGIYTLTATNSLGKASKDIKLTILGRPGPPVGPVKIEEVFAERIGLSWKPPTDDGG
SKITNYVIEKREDNRKTWVHVSSDPKECAYTVQRLTEGHEYEFRIMAQNKYGVGPPLYSE
PEKARNLFTVPGQCNKPTVSEVSLESMTVEWEEPEYDGGSPVTGYWLEKKETTSKRWTKV
NRDPIRIRPLGVSHVVTGLLEGATYQFRVIAINAAGCGLPSLPSDPVVSRDPIAPPGPPM
PKVTDCTKSTVDLEWIPPLIDGGSKITGYFVEYKEEGKEEWEKAKDKEIRGTKFVVPGLR
ELGLYRFRVRAVNAAGVGEPGEVTEVIEVKDRTIPPEVDLDATVKEKITVHAGGVIRIIA
YVSGKPAPEIIWNKDDGDMPKEAVVETTAISSSLVIKNCKRNQQGIYTLTAKNEGGERKK
AVIVEVLDVPGPVGQPFSGTNLTTDSCKLTWYSPEDNGGSAITNYIIEKRESDRRGWTSV
TYTVTRHNAVVQGLIDGKGYFFRIAAENIIGRGPFIETASEVLIKDPISVPERPEDLEVT
AVTKDSISLAWRPPKYDGGAEVTSYVLEVRQIGKDNFTRVATDSKLMDRKFVHEGLKEGS
TYEFRVSAVNQIGQGKPSFSTKPITCKDELEPPTLDLEFRDALLVRVGQPCTLQGRYKGK
PTPTIKWFKNDEELQANDEIMLTSTKKTLCLSIEKAKRDHSGKYTVVVENSTGTQKGICI
VTVVDRPQPPEGPVVFEEIFRDHMVISWKPPLDDGGCAVSNYIVEKRDSNRDLWMPVTVS
CTRTTCTVPKLIEGREYIIRICAQNIHGISDPLLSAETKARDVFKVPDAPKQPLVKEVYK
DTALISWEPPADGGKPITNYIVEKRETMSNRWVRAGTERIFPKTEYWVPDLLKGCEYEFR
VMAENVIGVGDPSPPSKPVFAKDPIVIPSPPVKPMAIDKTKNSVTLSWEPPKDCGRGKIL
GYLLEYQKPGEEEWIQVNQTPESCPETTFKIVNLEDGMLYRFRVKAVNAAGESDPANVPE
PIRAQDRLEPPELLLDMGMPRELKAMAGTHIKIVAGIKGMPFPKVTWKKNDTEVPPRAEI
ETSGVRTKLEMRYCNRGDCGDYTLTVENPAGSKTATCTVLVLDKPGPIQNLRVSDVRSDS
AQLSWKDPEDNGGVRITNFVVEKKDVASAQWVPVCATSKKRSIMAKHLMEGTSYMFRVAA
ENQFGRSEYVETTKPVKAMNPLFPPGPPKDLHHVDVDKTEVWLEWNWPDRTGGSDITGFL
VEYQEEGERDWIVFKTVSIPECHVTGLEEGKTYRFRVKAENAIGLGRPDTTVPVLCQEKL
VPPIVEVDAKLIDGIIVKAGSTIRLPAIMRGIPVPTAKWVIDGEEIKSEGNTKIDTDNFS
TILSIAECTRNHTGNYILTVSNPAGSKTVSLNVTVLDVPAAPIGPVNILEVTPDSMVIDW
RPPKDDGGSPVTNYIVEKKESNKETWGGVSSGSTATRLKISRLQSGVEYVVRIRAENKMG
IGAPLESAPTVAKHQYEPPGHPGKPVASDISEDALTLGWTMPLYDGGSPITGYIIERRHK
GGKWIRVNKIPCKDLRFRVLGLFEGNDYEFRVFAENIAGFSGPSPISDPAKPCRPITVPG
PPVNPKVKDYSCTYADLVWIKPTRDGGSPILGYVVEWQKAGGEWDKVNKDDLIKQCAYRV
KGLTEGTEYRFRIRAVNMIGDGETREIPESVIAQDILIPPEIEMDVTCRTHVTVRVGHNI
NITGYVKARPDPEIIWTRGETVLERDKRTTLSKNFPVVHMRIKEAIRADHGKYVLKAVND
GGEASATITVTVLDRPGPCRNLKLTYVTKNSCMVNWDAPEDNGGTEITNYIVECREPSSR
TWSMISSDCTNRKVKAKLLENHEYLFRVSAENKCGPGQAIETKTPILAIDPLQRPGEPEN
FHVADVGKNFVFLRWRRPDYDGGSPNLGYILEKKAKDAEEWESLHDGIIKDTFFMADKCA
ENQIYQFRVQATNDGGESNWVKTSDVLVKEEIQKPVLDLKFAGTIVVKAGESVRLEAALR
GKPQPEVKWVKDKATEDNPRVTIDTGADYSKFLMTKAKRSDTGKYVITATNSAGSFTAYA
NISVLDIPGPVRDVRVTSVSTDKCRVVWDPPEDDGGCEVNSYILEKCETRRMVWSTYSDN
VVTTYCNVTHLVEGNEYIFRVRAENKMGTGPPMESKPVIAKTQYSRPGPPDPPEVTKIGK
DEMTVIWAPPENDGGKSITGYILERKEKRAVRWVPVTKSPISERRMRVTNLIPNHEYQYR
VKAENEVGLGEPSKPSRPVAAKDPIEPPGPPANLKVVDSTKTSITLGWSKPVYDGGAPII
GYLVEMREKIEMEGEKERDPEEGWSKCNTSGQLVLTEFTMLNLDERKQYEFRVSAQNQVG
MGRPAKLKDAVTPKEIHELPEIDLDASLRKGLSVRAGCPIRLFATIRGRPSPKVTWKRIG
IDNVVRRGHVDQIDTMTFLVIPESTREDSGKYSLTLSNPSGEKAVFVRVKVLDTPGPVGE
LEATDVTKTSCQLSWSPPENDGGSPILNYLVEKREVDRKTWTNCTNDLKKTSFKITNLTP
GTEYYFRVMAVNKYGIGVPKDSPKSYLAVDPMSEPDPPKKMDVLEISKNSAKLGWLKPLR
DGGSKINGYIVDYQEAGQPEDKWTSYSVVKDLSIVVVGLKENTKYRFRVAARNSIGCSLP
REAEGIFEVKEHLMAPKIIMPDVVTAKAGTKLNVEALVSGKPVPVTTWKRGSDDVVTSDR
LSVQKTLSSSTLMIKDVSRKDSGYYSLTAENSISKVNQILRIIIMDIPGPPEGPLEILEM
DIDACTLAWNSPTEDGGSNITNYVVEKCDVSRGDWVPAVASCTKTSCRVVKLTPGKEYGF
RVRAENRFGISEPIYSEKMIARYPFDPPSEPRNCCVNKINKDFVVLSWERPVNDGGSPII
GYSIERKERNSLLWVKANETLVRPTEYSCSGLIEGLEYTFRVSAVNKAGQSKPSKPTEII
TARTPVDPPGKPEVLDVTRNSVSLVWNRPKHDGGSKLIGYYVECLKLPGDKWVRINASSQ
NVPKEEYIATGLEEGAQYKFRIIAKTAINISEPSEESDAITVIAEHVPPRVEISLEMKNL
ITVKAGANVCLYAEVYGKPLPKVSWKRDGVPLSLVEGMKMSQKRHLFLLELFSVTRKESG
EYTIVAENPSGTKSGNIKLKVLDKPGPPASVKISQVFADRVKLRWEPPLSDGGAEITNYI
IDKRETSRANWAQVTSNINGQITNCSVEKLIEGHEYEFRISAENKYGVGDPIVTTSVIAK
NPYDVPGPCDPPVITNVTKDHMTVSWKAPADDGKSPILGYMVEKREIQELSWSKINRKPV
IDRTIKAGGLTEGSEYEFRVIALNKAGLGKPSDPSQAALAVDPLYPPGPPAFPKVVDSTH
SSVSLSWTKPAYDGGCEILGYLVEVKRADSEDWLKCNMPKNLQDTKFLVSGLLDNTEYQF
RVTAVNKIGFSEPSEVPGKHMAQDILIAPEADLDADLRKALVLRAGVTLRIYVPIRGRPA
PKVTWSKVNANLKERQGLMINTTEWDTFVYCEDINRYDAGKYVLTLENSSGSKSYTIVVK
VLDTPGPPLNLTVKETSRNHASITWHPPQIDGGSPVKSYVVEKRLAERKAWTCVASECPK
TSFRITNLDAGKAYCFRVSAENVYGIGEGCETAGPVKASEQPGPVTEFKPALVTKDSCTL
IWKKPISDGGSNIVAYALEISEGEDKWKQLMKAKQLQYTVKDLQEGKEYSFRVKAYNESA
EGPTTELTVVAKDQIVLPDCDLKGLPDSCYVAKEGSTVRLTIPITGIPAPTVMWKKGGVA
LGDSGRVSVESTVTNTTLLIRDCQRGDAEKYCLILKNSAGTKEGTIDIKVVGKPGICTAP
IKFDEITADGITLEWGPPKDDGGSEISNYILEKRQSTNNKWVTVASAIQKNTMRVTRLHD
GTEYLFRVCAENKYGVGDFLRSDPVVAKHPFNAPEAPEPPQVLAIRHESAIVSWSDPKDT
GGSPITGYHVEFKDRNSLLWKRASKTPLRVKECRVTGLVEGLEYEFRVMAINVAGIGKPS
KPTEAFVALDPIDPPGKPDVINITRNSVTLIWTAPKYDGGHRLTGYIIEKLEHPGKVWMK
ANHVNIQSCAFTVTDLQEGCMYDFRIRAKNAAGAISAPSEQTDTLVCRDEYEPPTITIDP
EMKDGVTVRAGETIVISASSILGKPPPISVWSKEGREFKPSDVVQITSTPTSSTLSIKYA
SRKNTGEYIITASNPFGIKEERVKVKVLDVPGPPGPIEVSSVSAEKCTLTWLPPEEDGGC
AIKSYILEKRETSRLLWTKLAENVMDCRYVACKLIKGNEYIFRVSAVNQYGTGDAIQSGP
VKMVDSFGPPGPPSKPEIDNVSRTAVTISWKRPVVDGGSDIRGYSVERKERRGMRWVRAS
KKTISDLRYKVSGLTEGVEYEFRVTAENKAGFGVPSEPSQPVLTKDIAYPPGPPSNPRIT
DTTKTTATFNWGRPFYDGGLDVTGYIVEHKKEGEDDWIQDTTSPLRITEFVVPNLQAGGK
YNFRVSAINSEGCGEPAEVEKIVELVDREEIPDFELDAELRRTLIVRSGASIRIFVPIKG
RPTPEVTWMKDNVALKGRAHIDSTESYTLVVVPECTRYDAGKYILTLENVAGKKTGFVNV
RVVDTPGPPVNLKPREITKNSITLQWEIPIIDGGSKIKNYIIEKRDATRKAFTTITTNWQ
KCSYQVKDLEEGAEYYFRVSAENEQGIGEAAETPEPIRASQAPSSPDNLAVTDVTKDTAT
LAWTKPIYDGGSRITGYVIEAQKKGSDQWLHVTTIKALDYTVTDLTENAEYVFRIFAVNS
SGRSEPRESRPVEIKEQTTAPGFDLRSVYQKLVVAKAGDNVKVEIPVFGRPRPSVVWKKE
DQELKQTQRINIDNTTTSTILNIREIKRKDGGQYSMTGKNILGTVTETITVQVHDIPGPP
TGPIKVDEVSCDYVVISWDAPENDGGVPINNYIVEMRETTGTSWVELAATVIRTTFKAAR
LTTGIEYQFRVKAQNRYGVGPYITSEPVVAAYPFEVPGQPGIPQVVAFTKDSITISWNEP
STDGGSPILGYHIERKEKNSILWQRISKALVVGNIFKSSGLMDAIAYEFRVIAENMAGLS
KPSKASEMTFALDPVDPPSQPVALNITRHEITLQWMKPQSDGGFPITGYTVEKRELPNGR
WLKANFSNILETSFTVSGLTENSSYEFRIFARNSAGSVSKPSKPSEVIICRDDIEEPKLD
VDASFSHIVVVKAGDVFKLDANVTGRPIPSFVWTKDGKELEDTAKLEIKTADFYTCLINK
DSSRRDGGAFTLTASNPGGFAKFVFNVKVLDRPGPPEGPLHVTDMTTEKCILSWLPPLED
GGAKIEYYIIQRRETSRLAWTNVATDLQVNRYKVTKLLKGNEYVFRVMAVNKYGVGEPLE
SEPAVATNPYVPSDPPQAPEVTTITKDSMVVCWGHPENNGGSAITTYIIERRDKTGLRWV
KCNKRSVTDLRFKVSGLTPGHEYEFRILAENAAGLSAPSPSSPFYKACDTIFQPGPPGNP
RILDTTKSSITVAWNKPVYDGGSDITGYIVETCLPEEDEWTVVTPKEGLVGTSFTIINLR
ENQEYKINISALNCEGVGEPASVPGSPKAEDRYIPPEIELDSDLRKVVNIRACSTLRLFV
PIKGRPAPEAKWSRENGEPLDKASIETTTSFTSLVIENVNRFDSGKYLLTVENSSGSKTA
FVNVRVLDTPGAPQNLTIKEITKDSVSLIWDPPIIDGGSRVRHYLVEKRESTRKAYSIVN
ASCPKTSWRIGDLQEGSLYFFRILAENEYGVGLPVETAEPVKISEKPLPPGKVTLKEVTG
SSVTLSWEKPDHDGGSRITGYVVEMQGKGSDKWTQVMTVKVTEAVIAGLTRGEEYSFRIS
ATNEKGTSDPRLLSVPVVAKDLVITPAFKLLFNTFSVLAGDDLKIDVPYVAQPKAAVTWF
KDGTVLKETTRVNSEVTDSHLYLVIKEATRDDVGKYTIKIINSAGEATADITVVVLDKPG
PPTGPIKIDEVTADSVTLSWQPPEYEGGCTINNYIVEKRDTSTTNWQIVSATVARTTTKA
ARLKTGCEYQFRIAAENRYGKSSFLLSEPVIAQYPFEVPSAPGTPTVQSATKETMVIVWN
RPSSDGGSKIIGYHLESKERNSLLWVKQNKTIIPDTRFKVSDLEEGIEYEFRVYAENIVG
LSKASRVSEIQVARDPCDPPGKPEAVIVTRSSVTLRWTAPEFDGGSRITGYVVEKKELPN
GRWMKASFTNIIETEFVVSGLVEEQQYEFRVIAKNAAGVYSVPSDSTGAITAKDEVEPPM
IDLDAKYSQTIIVNAGESFKIDAGISGKPIPSVHWIKNGEELANTARLEIKNTDFTASLS
VKEAIRVDGGQYTLLLKNVGGEKSININIKVLDRPGPPDGPISIYGVTSEKCCIAWKTPL
HDGGAEISHYIVERRETSRLVWTVVESKVQTLNLKITKLLPGNEYIFRVIPVNKYGIGEP
LESDPVIATNPFVTPDPPTGVEISNITKDSMVVTWERPINDGGNAITGYVIEKRDKEGVR
WTRCNKRLVSELRFRVTGLLENRSYEFRVSAENAAGIGKPSAPTVYFKALDPVFRPGPPN
NPRVIDISRSSVVLHWSKPIYDGGCEIQGYIVEFCEGTSDEWTMCTPPTGITETRFEVKK
LLEKHEYKFRICAINKAGVGEHADIKESILVEDKLEAPDIDLDADLRKMITVIAGGALRL
FVPIRGRPAPEVKWGKAEGEINETAQIDITSSYTSLVIENINRFDSGKYTLSLENASGTK
SAFISVRVLDTPDAPANFHVKEITKNSVTLTWEPPLLDGGAKIKNYIVEKRESTRKVYST
VASCNKMSYKIEQLQEGSNYYFRVLAENEYGIGLPAETLEPLKISEVPQPPGKISVVDVT
RKSISLSWEKPEHDGGSRITHYEVEMQAKDSEKWSVCAQVKSLDTIITNLVQGAEYNFRV
IAVNDKGKSDPRHLAHTVLAKDLVIEPSVRTKLSTYSVQVGHDLKIEARITGHPKPIITW
TKDGTELKQTTRVNVADTAHHTTLLIKDATRDDGGMYNITVANVLGQKEATVEIIILDKP
GPPTGPVRIDEISAESITLSWDPPTYTGGCQISNYIVQKRDTTTTNWAVVSATVARTTLK
VGNLKTGAEYQFRIFAENRYGKSYAIDSEPVVAQYPFKEPGPPGTPYVSAFTKESMVVEW
HKPVSDGGSAILGYHLERKEKNSILWTKINKMLIQDTRFKTSPLEEGIEYEFRVSAENIV
GIGKCSKVSEGCVARDPCDPPGTPVPVIVTRHSVMLRWTPPEYDGGSLVTGYIVEKRDLP
DGRWMKASFTNILETEFTVTGLTEDSKYDFRVIARNGAGSVSKPSACTGPITAKDEVEPP
TYEIDSQYSQVMIVNAGDTFVLQASVLGKPVPTMQWFKGDVEVENSARAETKNTDFKAVL
VIKDAIRVDGGQYTLQLTNVGGTKSVPFNVRVLDRPGPPAGPLTVSNVTSEKCSLSWLPP
VHDGGSSISHYIIEKRETSRLTWTVVSSDCGATMFKVTKLLKGNEYIFRVMAVNKYGVGE
PLESVPVIMRNPFVPPGPPRELEITNISRDSMTVCWTRPESDGGSEIVGYIVEKRDRAGV
RWTKCNKRRITDLRFRVTGLTEDHEYEFRLSAENAAGVGQPSPATLYYKACDPTFKPAPP
TNAHITDTTKDSVTIEWSRPIYDGGLDIQGYVVEICKADEEEWLTCTPPTGLNDTKFTIT
KLIEHQEYKVRICALNKLGVGEPVTIPGTVKPVDKMEPPEIELDSELRKGIVVRAGGSMR
ISIPFKGRPTPEINWTKDHGDLPSKAQIEKGLDYTQLSVDICDRNDAGKYILTLENSSGT
KSAFVSVKVLDTPGAPLNLTVKDITRNYVTLVWEPPLIDGGAKIKNYIVDKRESTRPAFS
NITTKCTKTSLRVGDLDEGGIYYFRVMAENEFGVGLPVETEESVKTADPPLSVGKVTLTD
VTKTSASLSWEKPDHDGGSRILGYYIEMQPKGSEGWVVATTTKTCEGTVTGLSAGREYLF
RVSAYNDKGKSDPRPLAAPVIANDITIEPALKLTFNTYSVKYGGELKVEIPVKGRPTPKV
TWTKDGHSLKETTRLNVSSTATSTILSIKDANREDSGKYTVTAINNVGSVSEEIGVIILD
KPGPPVGPVKIDEVSANYVIISWEPPVYTGGCQINNYIVEKRDTTTTAWQIVSATIARTT
IKISKLKTGSEYQFRVFAENRYGKSSPLDSVPVVVSYPFSEPAAPGTPFVSSVTKDHMTV
EWKPPSNNGGSPVLGYHIERKEKNSILWTKLNKLLVTDTQFKTNGLEEGIEYEYRVFAEN
IAGISPSSKVSETVVARDPCDPPGTPEAIVITRNLVTLQWTRPQYDGGSVVTGYIVERKK
LPDGRWMKASFTNIIDTQFTVTELTEGDRYEFRVIARNAAGILSEPSESTGIITAQDEIE
APSVSMDSKFKDIIIVNAGETFAIDADIAGKPLPDIRWLKDGKEIDSATPRMEIKSTITH
TVLTVKDCIRVDGGHFVLSLSNVGGTKLVPVNVKVLDRPGPPDGPLKVTGVRAEKCYLHW
SHPTHDGGASVSHYIIEKRETSRLSWTMVEPKIQAISYKVTKLLPGNEYIFRVMAVNKYG
IGEPLESEPVVARNPFKTPGPPSTPEASAITRDSMVLTWDRPEDDGGSPIEGYILEKRDK
EGIRWTKCNRKRLTDLRFRVTGLTDGHSYEFRVSAENTAGVGTPSEPSEYYKACDATYPP
GPPNNPKVTDHSSTTVSLAWSRPIYDGGAPISGYIVEMKEACDDEWTLCTPNTGVQTTHF
TVKNLKENAEYKFRICAINIEGAGDHVDVPGSVIAAEKLEAPEVELEADLRKIVTVRASA
TLRLFVTIRGRPEPEVKWTKAEGPLTERAQVEVTSSYTMLVIDNVDRFDTGKYILTLENN
SGTKSAFVNVRVLDSPSAPVNFVVKDIKRDSVQLQWDPPHIDGGAKITHYIVEKRESKRM
AFTSVTNNCVRNSLRVDDLQEGGVYYFRVLAVNELGVGLPATTTEPVKVSQAPLPPGKVT
LVDVTRHSVSLSWEKPDHDGGSKITGYIVEMLTKGSDKWTVCTTVKMPEATVEGLTTGEE
YSFRISAMNDKGKSDPKPLGAPVVAMDITVEPVIDLLFHTYSIRSGEDLKIDVPFRGRPH
PEVTWKKDGHTLKQTTRVNVLTSKMSSKIVIKDAIREDAGKYEITLTNSVGVKSAEITVI
ILDKPGPPTAVRVDDVSADYISLSWDPPVYDGGCQINNYVVEKRDTTTTTWQIVSATVAR
TSIKVSHLTQGTEYQFRVAAENRYGKSHAVDSAPIVAQYSFTPPGPPNDLQVAHATKSGM
LVTWKKPTSDGGSPVIGYHLECKGQSSILWTKITRGLVSDTQFKVTGLEEGLLYQYRVYA
ENIAGIGPCSKACEPVAARDPCDPPGQPVVTNITRTSVSLSWTKPENDGGAKVTGYIVER
RELPDGRWLKCNFTNLQETFFDVTGLIEDQRYDFHVIAKNAAGLLSQPSECTGPVTVKDD
VDPPRITIEEKLRQLVVVKAGDILRIDAEISGRPAPVISWAKDGKEIDSKARVEISSTFT
TTTLIVRDTIRRDSGQYVLTLQNVAGTRSLAVNCKVLDRPGPSSGPLEVTGLTAEKCTLT
WGPPQENGGAEIQHYIVEKRETSRLAWTLVYADMKATTCKVTKLLKGNEYIFRVRGVNKY
GTGEALESDPIKALDPFTVPAAPTNVEVTSVTSEAMTICWERPVSDGGSSISGYVIEKRE
KSGLRWVRVNKKPVYDLRVKASNLREGCEYEYRVYAENTAGLSEPSLPCPLTKAEDPLFL
PSPPVKPKIIDSTKSTITLSWNKPLFDGGSPVTGYSVEYRKTNDEDWIVGVQHTNNTEFT
VVGLTSGAEYVFVVRSINKVGPSEPSPETDPQVAKDREDEPVFLISNELRKTLIIKDGSS
FTLRVPFKGKPVPNVMWNKPDVDLRVRATIDTTDTCTSVTIEQATRNDSGKYTVTLQNVA
GTATLTLNVKVLDSPGPPASLSVKEVTKNSATITWDTPENEGGAPVKNYLVDLREASKKG
WTRVTESCPRLTYKVTDLQEGGVYYFRVTGENEYGIGVPLETKEGTKITEKPSPPAKLGV
TDVTKDTVSLAWSKPEHDGGSRITNYQVDALEKGQQNWIKCGVTKSTHFVVYGLRENGEY
FFRVRAENLAGFSDPKDMVLSVLVKDQLEAPEINMKNFQHNTVYVKAGSNLKVEIPLTGK
PLPKVSLSKDDQVLKSTMRFNSEVTPDCLLITLRDSVAHDAGRYDITASNSSGTTKSFIN
IVVLDRPSPPVGPVEMCDITEDSVSLKWLPPAYDGGSPITNYIVLKRETTTANWVEVSSA
VARCTIKIMKLTTGVEYQFRIRAENRFGISDHIDSPTVTVNLPYTIPEAPTTPWVSAVTR
ESITVNWKEPSSDGGSHIFGYHLQMKDKNSILWKKVNKTVIRATHFKVTNINPGLIYEFK
VAAENAAGIGPVSKISDAVLAIDACEPPTDVRVTDITKSSISLTWSKPSYDGGSKVTGYI
IEKKDGPKGKWVKTNLSKVSDTRFTVSGLIQDESYEFRVLAKNAVGSVSNPSATVGPVTC
VDTFGAPEIELPQEYLDVVKYRAGATVQLRIGIIAKPQPTIEWYKDGKELESGAQLMISN
TTDSACISIKDATRINTGTYELKIKNSLGSAYAAIRVLIQDKPGPPAGQIQFKKITADSI
TIMWDPPADEGGAMVTHYIVEKRESSRIMWSIISEKLEDCIVSVSRLIKGNEYIFRVRGV
NKYGVGDPLESEPVIAQNLFVPPSQPSKPQVTMITKSTMTVIWERPSLDGGSDIDGYYLE
KREKKSLQWFKVIKDPIRDTRQKVSNLTEGNEYQYRVCAVNKAGAGQYSDASIFYKAYDP
IDPPTEPTKLKVVDSTKTSITLGWVKPVYDGGSEITSYIVEQMTADEKEWVTISSKGEVR
TTEYVVSHLKPGLYYYFRISAVNCAGVGRPIEMIQPVQAKDILEEADVDLDISMSTQYTA
KAGRDVEIMIPLKGRPAPNVTWRRGDRNIGGDAKYTINNTEYSTTLIIPKVTRDDSGKYL
LEIENGVGEPKNITISVKVLDSPSACSKLVVKNVTRGKLTLSWDPPFIDGGSPITNYIIE
KKDAKLKAYSIVTTECANTSYKVEGLSEEIAYFFRVSAENENGIGDTCETTEPVRAAETP
GPVKNLVMVDSTNTSVTLAWTKPDHDGGSHISEYIIEKKADDAVTWSLGGTCRCCKYEVT
NLKELSEVFFRVYAKNEKGCSDFSQIGPITVKESLIPPEANLIDYPNGELSVRIGQNVNI
ELPYKGKPKPAIQWMKDDVPLKESEQVRFRQTENKASLTVRNARKENAGKYTLVLDNRLV
KNFFDIKVITLGPPSAPVGPIRFDEIKAQSIIISWNEPQEDGGGEITCYSVEKRETSQAA
WKIVCSSVVRTTFKIPNLVKGTEYQFRVRAENKYGVSEPLNSVDVLAQHQYKPPGPPGKP
VVFNVTSDGMTVSWDAPSFDGGSPITGYHLEKKDRNSLLWMKVNSSVISGREYRVIGLIE
GLEYSFRVYAQNNAGMSPVSEQSKHKLAISPVDPPGTPNCIDVTRDSVTLQWEPPKRDGG
SRIVAYSVERRQGRARWLRCNFTDISECQFTVTGLACGDRFEFRVIARNAVGTVSPPSQS
SGYIMTKDESVIPEIQFGAEKTLTIKAGENIKLSCTISGRPVPQVTWYKDGKQLDKMLVD
ITTSIGSSSLFIRDADRSDRGIYTVEAKNSSGTTKEDVLVRVQDTPGPPEGPLRFTNISA
EKATLWWSPPENDGCAAITHYVIEKRETSRITWALVTSKCEACSFSATKLIKGNEYQFRV
SAVNSFGVGKPLESDPIVAKMQYTVPDAPGTPDCTHVTGNSLTLCWTRPRHDGGNEIKHY
ILERREKKSLQWVKVSAKRPITELRHRVTNLTEGNEYEFRVMAENGAGVGPPSGVSRLFK
CREPTSAPSAPTVVKVRDSTKTSVSLEWTKPIFDGGMEIIGYIIEMCKASLEEWHRVNSQ
TCIHTTYTVTDLEPGEEYKFRVCAVNGAGKGEASEIPNAVQAVDRLTSPEIDIDADFKQT
HIVKSGGRVSLNIPFRGKPTPLASWAKADGELGVMVDINTTDTFSTLTIENCTRYDAGKY
TLSLENNSGRKSITLTVKVLDTPGPPGPLSFKDVTRGALTLMWDAPSNDGGARIHHYIIE
KREASHLSWQEVSPKCTRQILRVTNLAVGVPYFFRVTAENQYGVGEPCEMSEPIIATEEP
APPKRLDIIDTTSSSATLVWMKPEHDGGSRITGYIVETRKKGSDHWVVGGQTKSLKMVLE
GLVENTEYEFRVKAQNDTGVSYPRDALTSVIIKEPRIEPTADLSGISKQLITCKTGSSFA
IDIPISGRPAPKVTWKLEEIKLKETERVSIKTSNVKTTLLVKDAKRGDSGKYYLTLENAA
GAKTFSITVIVFGRPSPPTGPIEISGITAESCVLTWAEPTDDGGSDIANYIVEKRESGQT
SWQVVNSSVKRPTIKVTHLTKYMEYTFRVCAENKFGVSKPVESQAIVAEHPFVPPSPPTR
PDVVLVSANAISIKWDVPYHDGGSKVTGYWIEKKERNTILWTRENKIPCIECHYKVSNLI
EGLEYQFRVYAMNIAGLSKASEASRPVLALNPVDPPGKPEVYDITRSSVSIKWSVPFNDG
GSKLVGYVVERKASTGDDDETRWLKCNYTTITDNFFTVTSLEEGAVYEFRVIAKNCAGVH
SMPSESTGPITCKDEYTPPKAELDSKLVGETVTIRAGSDLVLDAAIGGKPEPRVCWSKGD
KELELGDKYSLTYSSTRAMAIIKSCNRNDTGKYILTVKNASGTKTAAVNVKVLDTPGPPD
GKITISRVTEEKCTVSWKIPLEDGGDFVTHYIVDRRETSRLNWVVMETECKTLSCVSTKL
IKNNEYIFRVRAVNKYGAGVPLESEPIIARNAYTVPTPPGAPEITAVGKQHVIIEWLKPE
NDGGSEIKNYLVDKREKSSVRWTRVNKTFTIYDTRLKITGLLEGSEYQFRVAAVNSAGTS
LPSEASEYALCRDPTYTPAPPSAPRIIDTTKHSITMTWTRPMYDGGSDVTGYIVEILEEG
TEQWYRATQKILTTNEYTAAGLTSNKKYRFRVAAVNSMGTGEFSEGSVETSPTERVEIPD
IELPEELKKTVCLRAGSTLRLNATILGRPLPVVTWRKSGIDLQSRGYIDTTGSTTTLIVE
KVHRYDAGKYTIEAENPSGKKTITILVKIYDSPGPCGAVKVKDYTKESVVITWDVPTIDG
GAPINNYIIEKREASMKSYKTVTLECKKTLYRITGLEEGTRYFFRVLPENIYGIGEPCET
TDSVLVCEIPSVPQDLQVIDITKSTVILGWEKPLYDGGSRLTGYVIEACKKGTDRWMNVA
NVRASVFQHTIDSLNENEEYFFRIKAENDRGVSEPRDLLTPVTIQEQRVTPKIDLTSIPQ
KIVSVHAGKPIVLDIPITGRPAPTCTWFFGGIKMKDKLDRIKIETTAKYTKLMVRETTLD
DTGDYTLEVKNITGVATEIIKVIILDKPGIPVGPMRIDEIDATSVTCSWEPPEKDGGANI
SGYIVEQRDAHRPGWLPISESVTRPTFKFTRLNEGTEYVFRVAATNRFGIGAFLQSEVVE
CKSAKTVPGAPSTPEIFDVSHDGMTLTWKPPEDDGGSSVAGYIIERKESRSDRWVRINKN
PVTMTRYRSTGLIEGLEYEYRVTAMNSRGTGKPSLSSKPVIAMDPIEPPGIPLNPRVTDT
TRTSVSLAWSPPEEEGGAVITGYLIEMQKVDQIEWTKCNTTPTKICEYTLTHMPQGAEYR
FRVMACNAGGPGEPAEIPGVVKVTEMLEYPDYELDTKYQEGYIVRQGGVVRLSVPIKGKP
YPTCKWTKEGRDISYRAMIATSEERTELVIKEAHRDDTGTYDLVLENKCGKKAVYIKVKV
IGPPDPPEGPLEFDDIQARSVRVSWRPPSDDGGSDILGYVVERREVPKAAWYTVDSRVVD
TSLVVKGLKENVEYHFRVSAENQFGISRSLKSDESVIPKTPLCPPEPPSFPPEIMEVTKT
TVGLSWSRPKDDGGSRVTGYYIERRETSTEKWVRHNKTHITTTMYTLTGLIPDAEYQFRV
IAQNDIGQSGPGPVSEAVVCKDPFDKPSQPGDIDIISVTKDCITIHWLRPESDGGKEILG
YWIEFRQAGESAWKKCNKERSKDRQFTMGGLMEATEYEFRVFAENETGLSRPRRTAMGIK
TKLSVGEAPSLKEEMKDTTTKLGESGTLTCQIIGRPLPEIKWYRYGKELIQSRKYKMSSD
GRSHSLTVLTDEQEDEGLYTCRAINEAGEIETSGKLLLQAAPLFHPGFPLKEKYYAGCGT
SLRLHVVYIGRPIPQIMWFYGKKPLNPSENVIIENTENYTHLVVRNVQRKTNAGRYKVQL
SNKFGTIDTVLCVEIQDKPLIPEGPIIVEALLKNSVIISWKPPKDDGGSMITNYIVEKRE
AKEGEQWHLVSSSVSGTTCRIPNLIESAGYYFRVSAQNQYGISESLEIPAVVIIKSPYEK
PGIPQQPVVTSFTENSCVVTWKPPSSDGGAKIKNYYLEKREKKQNKWIAVTTEEIHETCY
TVKGLIEGFEYEFRVKCENIGGESDWSEISEPVIPKSDTAPRAPFFKEELRDMCVKYKAN
ATFVTKVIGYPRPIVKWYKNGKEILPDGEKVKIQEFKGGYHQLFISNADENDVAVYQIRA
TNQEGSISTTVTLDVEVPAKVHLPLHLQGMGAVHAVRGEVVTIKIPISGKPDPAVTWQKG
QEILNNTAYHQVIVTRSFTSLVFQKGVQKKDAGYYIICAKNRFGVDKQTVELDVADVPDP
PKDVKVSDIGRDFITLTWTPPNDGGSDIISYIVEKCPVSGDRWIRVAQTSEPQHTVLSLF
GKTKYQFRVIAENRFGLSNPSVPTEPVTAREDKLAIRNYDEEVDEEREVTKEEAPHSKVK
NVPSLYKISEELARCGHFGIVHRCVEISSKKTFLAKLIKVKGADRELVAREIETLNIARH
KNLLYLHESFDSLEEYVLIYEFISGMDIFERLGTNFDLTEREIVLYLRQVCHALKFLHGL
NYGHFDIRPENIVYTTRKSSTIKIIEMGQARVLTPGENIRIQFTAPEYFAPEVHNSDFVT
TATDMWSVGVLAYVLLSGINPFAAESTQKMIEHISSAEYIFDSEAFKYTSLEGMDFIDRL
LIKERKHRMTASEALEHPWLKMKIENISSKVIKTLRHRRYYQSIIKKEWSTVISAARVAY
GGGYRNQRNVSIGRVKIGHPEQGLRAGPVMHGSAELGGHVRFMCIIENYDKTTEVAWYFG
SRKLTASHKYEISYANGVASIYVKDIEECDDGLYRCKVVSEEREDNAYAELFVESVRSYR
EYFLGRSLKKPKRRIDRTKLLQRPPEFTLPLYNCSAYIGEDVRFGVTITVHPEPQVTWLK
AGHRIKPDPTKYTFTTDKGLYQLMIHNVEPDDDGEYTVVANNKFGEDSCKARLTVRHHPV
AEDTMRPMFRRLLANIDCVEGESVHFDLRVSGTPTPTLKWEKDGKPLEFRPQVELVQEDV
GYYVLHIRETLIEDSGTYRVTATNSAGSASCQATLKVERLTYIRREFKSEEDKQIYIQNQ
IKKTLKMAQEFSTAEVTTLNPVAQEALKEAAELYKPAVSTKNVQGEFDISDKEDKEIKRI
KEESRKIRMPYEIPEARVHDPTVLEEDMNIKYFVPLSDMKWYKKLRDQYEISERMERVVQ
KRQKRIRLSRWEQFYVMPLPRITDQYRPRWRIPKLTLDDLETVRPARRSPSPESDLFRQR
RHSLGDLSDEELLQPVEDYLTKRRIEEEKQQLEEELELGFSASPPSGSPVRFELHALRYT
SPRIMHKAEVKHTEETKHAVTPIKPSGSPPPLSHFMRRRRSLSPTYIELMRPVSELIRPS
RVPVEYEGEAIERRSPTPERTRPRSPSPVSPERRSSRSSSRFERSARFDIMSRYEARKAA
LKSERKYQVVTQQPFSLDHAPRITVRMRSHRVPCGQDTKFTLNVQSRPEAEIQWFHNGQQ
IQESSKYHFTDMSGVLTLQITDCQAEDSGTYRAVCTNSKGEASDYATLDVSGGAFTTYSS
RRKDEEAPAAFVPEVIKTDYYHTSSIRASSASRTHIEIKETKTKLTERHEVSGFEKYESE
RLASSPVRHASTEYLSSASYSSSERHVSAEYKAKSVESSATASITARKVKATLSAKILTK
PHSLTVSLGESARFTCDIDGEPAPSVTWMHGQHTIVTSHRVHVTTTQYKSTFEISSVEYS
DEGSYTVVVENSEGRQEAKFTLNISKPPTKEEAVAPSPPVKSLEPAVKSPELSVMSPTTS
VESPGPSVKFRTPPVTSPEPSVKSPEPLVKSPESTGVKSPEPQIKSPEGVKSPLRVKSPE
PSTAAPRVKSPVPAKPSEAITSPLRIKSPTALKSPEPVASPPRVKSPPPVKSPELRTSPQ
RVKSPTGMKSPEPITSPQRVKSPPAAKSPEPIISPKRVKSPLTVKSPTPSKEAPPKILQQ
LKAEASEDKVKMICVAECSVRDVVWYKDGRRLSHSSHYQIHTSADGTCCLYISDVSERDQ
GEYSCEIIAESGAVSKTSFSFFGQVFQSIYTKITTFVSAHMAVKESVSSKAHEGVEMLKK
ESATLSKMHESFSSKSVHMESTMQETSFSSSTMAEMKFETMSMSSMSSMTSESVYAMSSS
SMMSSHSHAEGSSIRATLLSGQGSAPKIEALPEDISIEPGKVLTIACAFSGEPSPHIEWS
CGGKTISTAEESGRFHIETTEDLTTLIITSVKSSDAGVYTLKLSNEHGSDMATVTISIRS
L
NT seq 94686 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaggcgccaacatttacacagccgcttcagagcgttgtggcacttgagggt
agtgccgcaacgttcgaagcccaagttagtggtaatccagttcctgaggtgagctggttt
cgtgatggccaggttctttctgctgccgctctgcccggcgctcagatctcgttcagcgaa
ggccgcgctgttctgaggatccccgccgtgacagccgcacacagcggaagattttctgtg
agagccaccaatggcgctggacaagccactagcactgctgaactcctggttacagcggaa
actgcgccacccaactttattcagagactacaaagcatgaccgtgagacaaggaagcaaa
gtgagactggatgtccgtgtgacaggaatccctacacctgtggtgaagttttacagagag
ggagctgagattcagagctcagctgactttcagattgttcaagatggagacctttacagt
ttgttgattgccgaggcttttcctgaagactctggtacatactcagttagtgccactaac
agcagcggacgtgcgacttcaactgcagaactactggttcaaggtgaagaggaagctgtg
cctgctaagaaaattaagacagtcatttcaagctctcagatttcacaggcccgccaaacc
agaatggaaaagagaatggaaggtcgctttgaggccgcatccatgcagatgcaaatggaa
ggagatattcttgttcaacagatggcccacaagactccaccacgtgtgccacccaaacca
acctccaggtcccctccatcccttgtgactaaagtttcagctactcgtcaacagtcacct
tctcctgtgaggcatgtgaaggcacccacaccaactcctgtcagaactgtatccccctcc
acaagactgtccatatcacccatcagacctgtcaagtccccagtgatgacccgcaaacag
gttacaacaagcacagaggttctgcctccatggaaacaggcgggctatgtgtctgagtcc
agctatgtagccagcatggcagctagagctgcacaggttcaaaccactactcaggtccgc
atggagcagcgctgggaaggctccatcgccatgcagcaacaagtcagcggtgtcgctgtc
aaagaggaacagcaaagcatggatgacaaatctgttgctgttgccactgtggtggcagca
gtggaccaggctcgtagtcgcaagccttttgctggctcagcagagcctcatggtgtagac
agcaccactgctactgttcttcctgcacctccgaccgagcagatcaagcacatttcttcc
atgacacttcttgagcaggctagtgagagagaggccattggttctctcccagaacacaca
acaactatggaaacaacctctagccattacacatttgcctctcaggagcagggtgctgag
aaaaaggctggagctgtggccaaagtgcttgctgcggtggatcaagcacgtgtacgaaaa
cctgtgcatgttgagagtgctttggctgaagaggaaatggacataaaacagcaggcaatg
ctaagtgctaagcaacaggctgcaagtaaagtggagctgttgcaaattcccagtgatata
ccaagcacttccaccgagcagaccgttcatgtcagccagatccaaagaactactgaggtt
aaggcccaggtggatactggccttgccccatccccagttcctcatttcacagtttcaaaa
gttactgttcctaaacctgatcatagctatgaggtctcaatagctggctctgctattgcc
acactacagaaagaattgtcttccactcatactgctcaaaagatcatcaagcctgtcaag
cctccaacttataagattgtggagacaagagtgactccagaacccacccctcctcctttt
agagatgccactgagaaatatcagttgcatttcgacacagagttacagagacagataggt
gcatcatatacaggggaatgggaaacacaggttcttgaaacagctgcagttccctcagct
gccaaggagccaagtattcctccaactgttgttgctggcttgaagaacctgactgttact
gagggcgagtctgtgactctggagtgccagatttcaggccaccccacaccaggcattatg
tggttcagagaggactacaggattgagagctccattgacttccagatcacatatgagcaa
ggatatgcccgtttagtgattcgtgaggcttttgctgaggatagtggacgtttcacttgt
acagctacaaatgaggctggaactatcagcacctcctgctacctgcttgttaaagtgtct
gaggagattgagaccagagcagagattactatggagaaacaggctgttattgagactaaa
gaagtggctacgtccgaagtcagagttgtctctgagactgtggaagctggagcagctgca
gctgcattctttgtgaggaagccagtttcacagaaacttgtggaaggtggaagtgttgtg
tttgtttgccaggttggaggcagccccaaacctcacatctgctggaagaagaatggtgtc
cctctcacatcaggatacagatatcgcgtaagttacaataaggacacaggagaatgcaaa
ttggaaatctccatgacatttgctgatgatgctggagagtacactatcactgccaagaac
cagcatggagaggtatctacctccacaagacttcttgaggaagaggaatatgaagcttat
atgaaaacactggatgtgacatacaaaacagaagtgatcactacagtggttcaggagccc
aaggtggcagacttgccccctgtggtcataagtgaatatgacatgcaaagaaggatggct
caacaagcacagatgatgacattcatatcagagagggaattccaaatctctgctattgag
cagagaatcattcaagagattgagataaggatcctaaagattacatatcgtgaactggtg
attgaggatggagaagaaatgctgttgagtgcagctgagcatgaggcaataggatcctct
ttcagcacacccgtcaaaagctacagaatcatggagggaatgggtgtgacattccactgc
aaagtggaaggaaatcccttgccaaagattgcatggtacaaagatggcaagcgcatcaag
catggaggccgttatcagatggaggttcttcaggatggtagagccactctgcgtcttcct
gtggtgctgccagaagatgagggagtctatacagcattagctagtaacatgaagggtaat
gctgtcagctccggaaaactctatgtggagtccacagctgctgctcagcctttttatcct
cagacagaagcaatgaagagagtacagtctgaatcccccatgtctgcacgctccattagc
ctctcccccggacgttcccctgcacgttctgttagccgttctcctgctcgcagactggat
gagacagatgagacccagctggaaaggctttacaaacctgtgtttgtcatgaaaccatca
tccttcaggtgtgccgaaggacagactgcaagatttgatttgaaagttgttggaaggccc
atgcccgacactttctggttccataacgggcaacaagtggtgaatgactacacccacaaa
attgtggtgaaggaggatggaacgcagtcaatgattgtggtgcctgctatgcctcacgac
tctggagaatggacagttgttgctcagaacagggctggaaaaactactgtttctatgact
ctaactgtagaagctaaggaaaacttgattagaccacagttcatcgaaaagctaaagaat
gtcagtgtcaaggaaggaaccttggttgagttggctgtcaaagccattggaaacccgctc
cctgacattgtctggctgaaaaacagtgacatagtatctcctcataagtacccaaatatt
aagattgagggaaccaagggagaagcacgtttcagaatcccccaaactgctggttctgat
agtgcatggtacacagctacagcaattaataaagctggacgggataccacgcgctgccgt
gtcaatgttgaggtggagttcgttgaacctgaaccagaaagaagactcattattcctaag
ggaacttacaaagctaaggaaattgctgcaccagagttggagccactgcatctccgctat
ggtcaggaacaatgggaggagggcgacctttatgacaaggagaagcagcagaagcctcac
ttcaaaaagaaactgacctcagtaagactcaagcgttttggtcctgtacactttgaatgc
agactcacccctattggtgatcccacaatggttgttgagtggctacatgatggcaagccc
ctggaagctgctaacaggttacgcatgattaatgaatttggctattgcagtcttgactac
gaggttgcatattccagagacagtggtgtcatcacatgcagagctaccaacaaatttggt
gttgaccagacctcagccaccctgattgtgaaagatgagaagagcctggttgaggaaagt
cagttgcctgaggggagaaggggaccgagattagatgaattagagcgcattgctcatgag
ggagctcctgctggagttactggagatgaaatcactgaaaaaactaagcctgagattgtc
ctgcttccagagcccattagagtgctggagggggaaactgctaaattccgttgcagagta
actggatacccaaccccaaaagtcaactggtacctgaatggacagctcattcgcaagagc
aaaagattcaggctactgtatgatggcattcactaccttgagattgtggactgcaagtct
tatgattcaggagatgtcaaagtattggcagagaaccctgagggcactgcagaaaacact
gtgaagttagagatcaaacagaaggaggatttcaggtcaattctgcggcgtgctcctgag
attaaggctccagaaggtcctggccctgagcatggcagagtatcttttgatgttgttaag
gtggataaacctgctgagccctcacaagccaaagaggttatcaagctaaggagggctgag
agagttgttcatgagaagcctacagaagagacagaggaattaaggagcaaattcaaacgc
agaactgaagaaggctactatgaggccatttcctcagtagagtttaaatctcgcaagaag
gatgagtcctatgaagatatgctgaagaagagaaaggaggagcttctgcactggactaag
gagatacctgaatctgagaagaagaagatagaagaggaacgcaaacttaccattcctacc
atcaagcctgagaaaataactctttcccccagcatggaggcaccaaagatcttagaacgt
attcagagccagaccgtcaccctgggggaagaagtacgcttccgttgcagagttgttggt
aaaccagatccagaatgccaatggttcaagaatggaatcttgctggaaaaatctgaccgc
atttattggtactggcctgaggaccatgtctgtgaactagttgttagggatgtctcagct
gaagattcggctagcattatggtaaaagccgttaacattgcaggagagacttcaagccat
gctttcttgctggtgcaagccaagcaagttataaccttcacacagcaaatagaggattta
catgccaaagaaaaggacaacatggtaacctttgaatgtgaaacaaatgagccttttatc
aaggttaaatggttaaagaacaatgttgagattttctctggggaaaaatacaggatgcac
tctgacagaaaagtgcatttcctgtctgtcctgattatcagcatggatgatgatgctgaa
tacacttgtgctgttgttgaggatgaccacataagaacatcagccagacttcatgttgaa
ggtgcaccacttgaaattgtgaagaatttggagagcattgaagtaccagagtcatatgca
ggggagtttgagtgtgaagtgtcccgtgaggatgctgaaggcacctggtactttgagaac
aaagagatcaccccaggtatgaagcatgttatgtcctctcgccgtggaagacacagcctg
tgtgtcaaggatgtgaagaaagaggaccaaggcaaatacactttcaaaatgggtgatcta
aagacaagtgctaccctgaagatgaaattgcgcccagttacactgatgcaaggcctttct
gacttaaccgtctgtgaaagtgatattgctcagatggaggtgcgattctctcaggagaat
gtggagggaacttggttaaagaatggtcagcccatctctcctactgataggattcacatt
gttatcgacaaactggtacacaagctccttattgaaaacgtcaccaaagatgatgctgga
acgtactccttcaatgttcctgctcatctcatttccactacaggaaaactaactgttcaa
acaattggtattgtaacacctctaaaggatgttagcacaattgaaggcacaaaggctgtg
ctagaagccaaaatttcagctgctgatgtgagctcagtgaaatggtaccataatgacaag
ctactgactgctagtgacagagtccaggtcgtgactaagggctccaaacagcgactagta
ttgaacagggcatatgcttctgatgaaggacaatataaactggttgttggcagagttgag
tcatcatgcaagctaactgttcagaagatcagtatcgtaaagcacatggaggaccgtgtg
tgcactgagacccagaatgtcacatttgaggttgagctgtctcaccctggcattgatgct
ctctggacttttaagggtcaacctctgaaggctggtcctaagtacaaaattgattctaag
ggcaccaagtatagtctcattgttctcaatgccatgaaagatgaggagggcccttacgtg
tttgcagctggtgaaaagacttcaagcgccaaacttacagtatcaggcggcgccataaac
aaaccactgcaggatgtaactgttgcagagtcccagacagctgtgttagagtgtgaagtt
gccagcgcatctgctgagggaaagtggcttaaggatggacatcctgttgacttcagtgat
aacgtcaggagtgaacagattggtgctgtaagacgccttgtcattgtcatctcaagaccg
caggatattggagaatacacataccaggtggcaaactctaagacctcagctaacctgaga
gttgaagctgtaaaggtcaagaagacactaaagaaccaaactgtcattgagacacaagag
gccgtgttcagtattgaactcactcatttagacgtgaaagggtcccagtggatcaagaac
ggagttgaacttcttccgagtgataaatatgaaatcacagtagaaggcatggttcacacc
ctgaagattaaaaattgtaacacccaggatgaatcagtttatggattcaaactcggaaaa
ctcactgctaatgcaagactcaatgttgagacaattaaaattgtgaagaagccaaaagat
gtgacttccctgctaaattctactgcttcctttgagttaagcgtatcccatgataatgtc
cctattaaatggatgttcaagaaccaagagcttaagccaagtgccaatatccaaatcctt
tcagagaggaaagctcacaagctggtcatttccaatgttgaggaaaacatggaaggagaa
tacacagctatagtgggacatgtgcagtgcagtgcatttttacatgttgagtctttgagg
gtcacaaagcccatgaagaatattgagattccagagacccaggtggccacatttgaatgt
gaagtttcacattttaatgttccgtccacatggctgaaaaatggagttgagattgaaatg
agcgaaaagttcagaatagtggtgcagggcaaactccaccaactgaagatcatgaacacc
agcagagatgatactgcagaatacacatttgtctgtggaaacgacagagtctcagccacc
ttgactgttacccctatactcatcacctccatgctcaaagacctcaacgctcaagaaaag
gacaccattacatttgaagtgactgttaattatgagggcatcacctacaaatggctgaag
aatggtgtagagattagatccactgacagatgccagactcgttcgagacagtttactcac
tctctcaccatccgcaatgtgcactttggggatagtgcagagtacaagtttgtggcagga
tctgctgagacatcagcaaagctgttcgttgaggctcgtgtcattgagttcacaaaacac
atcaaagatatcaaggtgactgagaagaaaaaggccatatttgaatgtgagctctctgag
cccaatgttcaagttacatggatgaaaaatgggcaggaacttgagatatccgaaaggttc
aaggtttccacagacaaatacattcagcgcttaatgatacagactgttcgcatgtctgat
gctggtgaatactcagtggttgctgggtcaagcatgtccaaggctcacctcacagtagag
ggcaaagatgtccgcattactgaacctgttgagaaagaaataacggtgcttgagaagcag
agagctacactggaatttgaagtcaatgaggatgatattgaaggacgctggctcagaaat
ggtgttgaaattcaattcacacttgataagcgatatagctatgtgaccattaggaaaatt
catcgcttgacaatcactgaaacctggaggagtgatgcgggagaatacactttcattgct
gggaagaacaggagtgtggtgacactacatgtcaacattcctgagcctcctcagatcatc
aggcatatggaacctttgtctgttgaggctggtaaacctgcacgcttctctgtggaagtg
actggcatccctcagccccaggtctcctggtataagaactctcaggcattatctcctgga
ttcaagtgcaagttcctgagagaggcaaatgaacacactctgctgctcattgaagtcttc
ccagaagatgcagctctgtacacctgtgaggcgagaaatgactatgggcaggccaccagc
tctgcttcgctgaatgttgaagttccagaggttgtttcacctgacactggtgcaccttta
tccccacctgttatcatatctccaatacaacacacctctgccactgaaggaggatctgcc
agatttcagtgccgggtgtctggagaagatctgacgattacctggttctgcaaagaccaa
gagatcaaacagtcaaacttcttcagaatgtctcaatttgacgacagctgtcagctggag
atcgccagagtttatcccgaggacgaaggagagtacacctgtgttgctcgcaattctgct
ggaatggtttcttgctccgcagtacttaaactggaagggaaaacacaaattattgacata
acatctcaggaatctcagtggcatgccttgtccagtctctctacaagcattaagagtgta
aagaaggagccagttggtcagaagcccacttttattcaacctcttgtaagctgcactgtg
cctcatggggaagtggccagattttatgcttgtgtctctggcataccaaaaccagagata
agttggtttcatggccaggaacctgtaaagtcaaacaaaaatattgtctttcattttgat
gaaatgacaagcactgccacattaatcatagttgatgctttctctgagcatgctggacag
tacacttgcaaagcaaccaattctgctggagaggctgtttgtacagcaacccttacagta
cccacagaagttaccaaacgtgaggatattgaaaccaagattgaagaagtcgtcaaagag
tattctagtttgacttggaagactgacgaagaagaagaagaagaaaccttcagcacttct
ctacaattacctgaaacagctaaaacacttgaactcaagccagaacaaaaacattactcc
agttctttcgaaaagaaaaagaaagcacctgattttataaccaagttaacaccatctgta
gtcacagttggcagttcagctaggtttactgtcactgtatctggctttccaaaacctaaa
gttcagtggtttcataatggaaaatccattacttcttcatctgtgcacaagtttgtggag
gaaagaaatgaatacagtctaattatcagtgaggttaaaaaggaatttgagggcgagtat
tcttgcactgccagtaacagatttggccagactacctgcacaacaacactgaaagtagaa
attagtgatttatctccagcagagaaatgggttgagaaaatgtttaaaattgctggagag
ccaccctgttttactacacaaatccagtcagtgcagtgtgctgagggatgtgaggctaaa
tttcagtacaaagtgacagggaatcctcatccagaggttcagtggtttaagggtagttat
caaattaaacctagcccaaattgttgtgtagtcacagaccctgatggcactggttttctt
ataatgattgatgcacagcagaaggacagtggtctctacacatgcagggcttccaattgc
tttggagaggcaacttgcagtgctgaattggttgtgtttcgtaaaagtttctcggtatct
catcaacagcagctagctcggggtcaaaaggcttataaagtgtccacaactgaagaagca
actgaatctcgattgtacagtgtaagtcttcctattcaagccagaacccgagtgcaggaa
ggacaccagatgatttatacaattggcactgaagataaacacactatagccagtgaacaa
gtaggtacattctgtgagatagatgtttcagctgcaaccatgcacaaggagcaggtaact
caccaagctgcagttctgcagtctcacaagatgcaggaaagagtaactgtaactcccatc
cagccacaatcagctgtggcaacacctctgaaacagcttcacatggctgcaatgacctct
gctgttcaagaaaaccaaggtttcacagagcagcattttgaccgtattaaaagtcctgaa
gttacagagcttgaaattgcaatggagcagccatcaaagtgtatgtctgctataacagag
agtgtgactcctctaacaatagttaaagcagagcctctagctaggcaagaagaaaagcag
ctaaaagcaactcctgagcccaagcaccaaatgttaagtcaccaggtagaaacagccctc
gcaatagttaaagagcaatcacagattataccacagacagaagcggaaaagagctaccaa
gttaaagagggtattaaaatattgtattcagcagtttccacagaaaaacaacaactaact
gaaggacatgcaacagatatctctgttttagattcagccattcggtcatcagtaaagaca
gaatcttcaaaaccagtcattctttcagtaagtgagaccaagcaaatgctatcaaaagag
gagaaattttctatgcagaggacaaatgaagagactgcatctctggctaaggatagggta
ttaaggtcagctcttgttgctgaggaaacaaatgaacttaaagctgatataacaagtata
attccaggtttggacagtgctgtttcagttcacacacagagtgaagaagaacaggtattt
aatttacagatatttacagatcagacagttcttccctctgagggtagattcagtagtgag
aggccaagtcctgagcaagcagaagttagaaaatctcctactcttatgcagacagtgtca
acagatgatcaagggactgttacatgtgaagagtcaactcagttatctgttcaagagaca
gcaatttccatagtccctcgtaaagaggttcctgccccgttgcatctacaggcaattcac
ccagacaacatgctatcgaaagaggggatactctcagcagagcagccagaccagcagatg
gcagttctgagacaggaaagggcccgcaaacatgcagttactacagaggagaaaagggag
ctgacagcagactattccagagctcttgatgtttctgtgtcaggatttcaatctgaaatc
aggaaagaaccaaaacctcaaaacattttgcaagtgttcacagaagcaatgcaactacca
aaagaaaagccatttgccagtgacattaagcaacaacgtgcattagtgcaaaaagaggat
cactggaatgttttacatgccatgtctgtatcagacagaaaagatcttgacgaaggacat
acagagaatttaggtgcagctgaacaatacacatgcttgactaagatggaacctaaaata
tcatcagaatttgttcatgttgaggagaaggcaatctctactgaaagtacaatttctctt
gaggctgcagaacaagactttgctgttcagattcaagaaggacagtccattagacagtca
atattaatggaagagaagcatgttataagaggtgaagtatctcagaatattacaaaatca
gaaactaccattgctgtggctagtcagcagcaaatgggtgctctactagtgtcagagtcc
agagaaagccaggttcttccaaaggaacttacttttgttatctcagcaccaaaagcacat
agcttagacataaagcaccagttgaaaaacatgctttcatctgctgtagctagagatcag
ccattaatcctcgcagatgtggttgaacgtttagaagttgttgaagtgcaggaagtgaaa
gtgcagaaggagcccaagtatattatattcacatatcttattacaactgcgggcgctccc
attgagattacaattgcttttgagggagagtatcctcagactgccgacctcaagagtgaa
cttcaggctgcattttattccattatatttcgtgagcatcaggttcttacctctgaacag
ccaggaacaatgcaaattgacaggccccagagatcacaagttagcagggctacctccaag
gaaaggatctcaccaatggtagagactgtgcgattaactgaaaatgcggaaggttttttg
ccacctaaaactcaatcagctgctctgaaaactgaaggcgcagccactttccagtctgtt
agttttcagaaagaaactattgtggaagactctaggagtagaatgatgcagatgtccaaa
gagtcaaaaatggaattgaagcaatctgttcatactgaaaaacaggaaatcagatcagtg
acagtagaaagtcaagaaagagatgtaggtgcaggagatatcacaactagtgtgtctttt
gggcaagtaccagttgaacaacctgctgatgtattcgttaggagtgaaggactgcagaaa
tatctaatggaagagacaatcatattacaagaagaaacagttagggatgatcactcagtt
tttgaaagtactttagaggacatcacccttgatgaatattctaaagcaaccttttctgta
actataagaaatgtttcaaaggtgaattggctttttaatggaaaacaaattaagtctggc
aaagagttcaagtgttcaaaagacagggacacctatacactagtaatagacaatgttatc
aagaaaaaacatgaaggcgaattcacgtgtgaggctgtgagtgaagctggcacaacaagg
acatcatcaaggctcacagtagtcacaagagtgccacctgttttcaggcataaaatccat
gctctggagactaatgttggcagccctgccaaatttgaatgtgagattgaagatgctcct
aatgttaccttcaaatggttcaagtctggttctgagatcaggcagagcgacaagtacaag
atcatcagccactctaccacatcatcgctggagcttctgagtccaacacaagctgatagt
ggagagtatatgtgcagagctttaaaccaacatggtagcgacagttgctctgctaacctg
actgtgacagaggttttccctccagaatttgtgtcaaagcctgaaccgatgacattattt
gtgggcaaacaagcaaaatttcagtgtgttatcactggttctgcgccaatgaatgttgta
tggtacaaggacaacattgctattttgcccgatgagcactataacgtgtcctttgagaag
aacaagcattgtcttgagatcatgaaacttgagcaaaatgatcagggaacttacctttgc
aaagcttctaacagtgttggcatggctacatgctgcactgaaatgagagttatagacaaa
cccagttttgtgaagacctttgaatcaacttctgtagctgtgggtaatccactgcggctt
gagtgtcaggtaaatgaagatacaggagtgactatcacttggacaagggatggcaagaaa
atccataacactatggatagcaaaatttcttttgatgagaaagtggtcagccttgatatc
ccaaagaccaagattaaagatacaggcacttatgtctgtactgctacaaatgatgctgga
agcagcagctgttcttctgtggttacggtgaaagaacctccggtatttgttaagaaactg
gagcctaagatcctgtggaaacaaggcatttctgcacgcttattgtgcgctgttaaagga
tctcctgagctccatgtcagttggtttttaaatgacaaacaactcagttccagtgaaaga
cacaaaatcatcttcaaagatggtcaagctacacttgagattattgaccttactgtgtct
gacagtggaaattacacctgtgaagtaatgaacgaggctggctgtgaaagctgtagcacc
aacttgactgttaaagaaccccctgctttcaaaaaggagttagaaatggtggaagtggtc
aaggggtatgctgcaaaattccagtgtgaagttactggcactgctccatttgatgtcact
tggtttaaggataagaaaccagtgaccattgataaaaagcacaacattgtaacaaaggac
accatttcatatttggaaatacattcatttgacagtgcagatgttggggactaccaatgt
gttgtttcaaatgatgttggtaaaataacttctaaatcagtagccaaactgaaagaccct
ccatcttttgtaaaaaggattgaaaacacaactgcagttttgggcagtgctgtgaaactg
cagggtgctcttaaaggctcagcccctatcactgtcacatggctaaaggattctgagcta
ctcagacaagatgatcctaatattacaatgacttttgaaaacaacattgcaagtttggca
atagcacaaatagccatgaaccatgatggaaagtacacatgccaagctgaaaacgaggct
ggccagcaaaaaagtgaagccaagttatcagttcaagaacctgctagaattgttgataaa
gcaccatccatcagtgtaacagcaggagactctgcaactttggaatgcactgtgtcagga
agtccggatctcaaagttaaatggcttcgtgatggcaaggaagtgataggaggccgaaaa
tataaaatctcttttaaggaaaatgtagcaagcttaaaaatcctctcagcagagagggga
gatagctgcgaatacacagtggaagtttccaatcgggttggaaaagaccactgctcttgc
tcagtcacagttcttgataaaattatacctccaaccttcacaaaaagtcttaaaaaggtt
gatggtaaccttggaggaaatatacagatggaatgtaaggtgtcagggtcgcagcccatg
acaatatcttggtttaaagatggaaaggagatcacaactgggataaagtaccaaactgaa
ttaaaagaaagcactgctttattgaaaatattccagttggagactgctgatgctggggtt
ttcacatgtcatgcaactaatgctgcagggcacagtgagaccagtggaacagtatctgtt
aaagagccaccggtcttcacattgaaacctgaatcgcaagatgctataccagggtctaat
gttgttttgaaagctgcttttattggaacaccaagttttactattaaatggttcaaagaa
gagaaagaaatatttactggagatacttgtttcatcaagaaagatgcttcttcaagtacc
ttggcactgcactctgtaaagccatcacattctgccagatatacttgtcaagttgccaat
gatgcaggaagtgtttcatgcaccgcagtcttatttgtgaaagagcctccaaagtttgtg
acgaaacttgattcaactaaattagcagtgaatggcagtgttgtggttttggagtgtgaa
gtaactggcagtcctgaaatttctattacttggtataaaaataatatagaaatcagccca
agcaataaatatcaaatgaccttcactgactcagttgctacactgcagatatctaattgc
agttttgaagagagcggggattatatttgtgtagcatccagcgatgctggcagtgacaaa
tgcagttgcttggttaccgtcaaagaacctcctgcgttcattaagttatttgaatccaga
gaagtcgtcaaaggttctgatgttgtacttgagggatctgtctcaggaacacctccattt
gaggtttcgtgtttcaaagactcaaagcagatcagaaatgaccgccggcatatcattggg
ataaagaatgatgtagttactattgagattctcaagtttgaacctggagatgctggcaaa
tataaatgcacagtagcaaatgaagtaggacagacatcgtgtgattgtgaaattatactg
aaagagccaccatcattcacgcagaagctagataacatggatgccttactaggcaccgag
cttaaaatgctgtgtgttctgaaaggctcactgcctatgacagtgtcatggacaaaaggt
gaccatgaggtcagagatactgaggatgtccagatttcttttgagaacagaaccgcagtt
ctgcatttctctaatgtgaagttaaaacattctggaaagtacacttgtcatgcccagaat
gaggctggaagtcagaagtgtacagcagctttggtggtcaaagagccagcaaatattaca
gagcaggccaagtctatcagtgtcacagtaggagatcctgccactctggagtgcaggttc
tcaggcactaaatccttgaaagttaaatggctgaaagatggaaaagagctgacatctggc
aaaaaatacaaaatacaaagcactgatacaagttccatattaaagatcctttctgcagag
aggaatgatgaaggcgaatatacatttgaggtttcaaatgatgttggcagcagcatttgt
gaggcctctgtaacagtactagatcaaataattcagccatcgttcacaagaaaattaaaa
caattggaaagtattaaaggatcctttgcacacttggaatgtctgatcgcaggatctctg
cctataacagtcacttggtttaaggacaacaaggagatagatacaaatgaaaaacataag
agtgttttctttgagaatgcagcatctttggaaatcagtcgtcttgatagttcggacagt
ggaaattacacctgcattgctacaaacaaagcaggcagtgcccagtgttctgctgtctta
aaagttaaagaacctcctgttatcattgagaaacctgagtcacagcaggtcatacctgga
accagagtgaaattcagtgtacttgtgtctggaactcccccgctgaccatcaagtggttc
agaaatagaaaagaagtcttatcaggtgttgactgctccattcagaaagacgactcttca
agctcacttgagctgtttttcactaagccatccgactctggagactacatttgtgaaata
agcaatgacgttggctcagattcctgccaaacaacactctttgtcaaagaaccccccaaa
ttcatccgaaagccagacaaagtttcagtagtgaaacctggacagtccgtaatttttgag
tgtgagattgtgggcacaccggaaatagacacatactggtttaaagacggtaatgactta
agtccagatgacaagcataaaatgagttttgtcaactctttggcacggcttgagattact
ggtgctgatcttaaagacagtggtgtatattactgtgaggcccgtaatgaggcaggtagt
gagagctgtagcatggatctgaaagtgaaagaaccaccagttattgtaaagccattcact
cctgtagaggttgtgaaaggtttgaatgcctcttttgagtgtcaaattagaggcacagct
ccttttaaaataacttggcaaaaagattccaaggagataatgccaagcacaaaacatgtg
ttctctcagaaaaatggttcactaatgttacttgacatacagaaatgtgatgacttggat
gttggcgagtaccaatgcattatttcaaatgaagctggaagttgttcatgtagagcaaca
ctaagcataaaagaaccaccatcatttgtagaaaagatccagaatgttactacagtgttg
ggaaatgtagcagagtttaaatgtgttgttaaggggtcacctcctctgaacatacaatgg
cagaaagatgaaacatggatcttggaagatgccgagattgtgagaacatttgaaaataat
gttgctacattaagaattcccaagtgccagtctaaccatagtggaagatacacctgccag
gctatgaatgaggcaggccaggagaagtgttttgccactcttttggttcaagagcctccc
cagattattgaaaaaccagaaattataaatgtcactgctggagatcccgtcagttttgaa
tgcaaggtaacaggcactgctgaactgaaagtgaaatggagtaaagatggcaaagaggtg
gtcccatccagacaacatagcctcagttttgtcaacaacatcagtaaccttaagattcag
tctgcgcagttagatgatggaggaacttacctttttgaggtctccaactacatcagtacc
tgcaagtgtaaagtgactttaaatgtcctagaacaaataattcctcctgccttcatcaaa
cccctgactgacatggaggagattctaagttccccagtaaaactagcatgcaatatatct
ggctcgctcccaatctctgtggagtggtttaaagatggaactaaactgacaggaaaaacc
aagcataaactcgttcaggaccaccacagtgtctctttggagattgagcggttagagaaa
gcagacactggaacctactcttgtaaacttacaaacaaagcaggcagttgtgaatgcagt
ggaacactgagggtgaaagaacccccaagctttgtggtagtgcctgagccacaggctgtc
ataccaaataccactgttcgttttaaaagtacctttaaaggaacacctcccttcatggtg
aaatggttcaaagaagatactgaactgattactggaccatcctgctttattggccttgag
ggcctttcaagcttcatagatctttatgctgtgggactttcaaacactgggccatactct
tgccaagttagcaatgatgctggtacagcgaaatgtaccacaagcttattggtgaaagaa
ccacctgaatttgtacagaaactaccagcaacaaagtttctaaagatgggattgccactc
cggcttgaatgcaaagttactggcacaccacctttgaaaattagctggtacaaaaatgac
aatgcagtcattgagagtaacaacatgatgatggctttcgatggctcgatggcagtgctt
gagattttaagcacctcctgtgatgatgatggagtgtacacctgtgaagttcagaatgat
gcaggaactaagagctgcagcaccactctctcagtcaaagaaccaccagttttccagaaa
gtgccctcacctgctgaggggttgaaaggcaaagatgtaagtcttagctgtgagctgaag
ggacatgcaccatttgagataacctggtttaaagaccaaaagcaactgaaggaaagtaga
aagtacaaatttgtgtctgagggacactttgctactctgcacattcttggactggaggca
tcagatgctggtgaatatgaatgcaaagcctcaaacaatgcaggaagtgatgcctgccaa
ggattggtgaaactcagagaaccaccagtttttgtcaagaaactgaccaatatgacagtc
atagctggtgaggaagttactcttgtggcaactgtcaaaggctctgagccaatcagtgtg
tcttgggtacaagacaaggaccatgttcttagagatggtgacaacagaaaaattacattt
gaaaataaccagatatctttgaggatctttaaagctgattcaaccactgctgggaagtat
acctgtgagattaaaaatgatgctggtgtggcacaatgcatggcaaacctaactgttcta
gaacccgctgccattttggataggacagagtctgtaagtgtcacaactggtgacccagca
gttttagaatgcactgtatctggaaccccagagcttaaaccaaaatggtataaagatgga
atggagctatcttctggacagaaatacaaaatcaccttctccaaaaagatatccagtctt
aaggtgttatccacagacaaaggtgatactggagagtacacctttgaggtctcaaatgaa
gttggaagtgatagttgcaagatgcaccttggtgttttagataaaattatccctcccaca
ttctcaagaaaattgaaggatatgcacagtatcgttgataaacctattgaattggattgc
aaggtctcgggttctgaacctcttaccatttcatggtatcacaatggcgaggagatcgag
agtgggccaaactatgaaattagttttgctgagaacacctgtacgctcaagctgcccatt
ctaaaactgtctgatgcaggttcatacatgtgtaaagcagtgaacagtgctggaactgct
gagactactgccttacttgatgttaaagaacctccatcttttgtgacaccccctcagcca
gttgaggcactcccgggatcaaatgtcacattcactgcaactgtgagaggaagtgcccca
ttaaggctgaaatggttcagaggcagtacagagattgtgtctagcagagcctgtgagatc
gctctgagaggagacatagctacactagaactctttaaaattgacaaatctcatgcagga
gaatacacctgtcaaattattaatgacgttgggaaggaaaacttccctgtgactcttttt
gtcaaagaagctgcacgctttgtcaaaaagctgaaaaacatctctgttgaagtgggcaag
tcaatggtacttgaatgcacgtatgctggaagccctaagattctggtgaagtggcataaa
gatggccaggagatcttctcctcttatagatacaatattacaactactgagagctcctgc
atcctggagtgtctcaactgtgataaagaggcaggaggaaaatactcatgtgacgtttcc
aatgaagctggccatgacacctgtgatgcaacagtgtccattttagagccaccattcttt
attgagagtttggaaccaatggaagtgactgcaggtgatgccgtctgtctgaaatgccag
attgggggcactcctgacatcaaagtctcctggttcaaaggggatggcaaagttcgatct
tctccgacctgtagaattgagtactccaaaggcgttgcctgtttgaaattagccaaaacc
tccaaagctgacattggagaatacacttgtacagcagaaaacagcattgggtctgcctct
tctagctgccacttaactgtacaagaggccaagacgccaccatcttttcccaagaaaatt
actagcattcagcaaactgtaggacatagtgtccagtttgagtgccgtgttgcaggatca
tctccactggagatctcttggcttaaagatggtgaagttctaaagagtagctcagagtac
actatgactttcgatgataactctgctgtactgagaattgcacagggagaaatgagacac
tctggggaatacacttgtgttgcaacaaatattgttggaactgcctcttgtagagccaag
ctcacacttcaagagccaagatacccacctgtgtttgatagaaagctttcacctgtggat
gtttcagttggaaatactgtgcaattggaatgccacatgactggatcattgcctataaaa
gtcacttggtcaaaggatcataaagatatccgctcagggggcaattataagatatcatgt
gtggaaaacaccccgcaactgactattctaaaagcagataaggctgactctggcctctat
tcttgccatgctagtaatgatatggggaaggactcttgttcaacagaggtcactgtgaaa
gaacaaaagattccaccaagcttcaccaaaaagccttcggcaacccttgaggaaactgaa
ggcaaactgttgaagattgaggcacgtgttgctggatcactgcccatgattgtcaactgg
tataaagatgacaaagaaatcttcagctctgacagatatgatatcaccttcagaagcaac
atggctgtgatggtgataaagagttcctccagctcagatagtggtacttatacatgcaaa
gtcaccaatgaggctggttctgcttcttgccaggttttggctcatattacagagcggaag
gtaccgccgaactttgacttgcctcttaaacctgtgacactgaatgagggtgagacactt
tcacttagctgccatgtacgtggctctccaccactgaaaattcagtggatgaaggacaga
agggagttgatgtcctctgctagcaccaagatcacctttgtagatggcaccgctacacta
gaaatgcttaatgtgtctaaaacagatgcaggagattacctctgtaaggcaaccaatgaa
gctggtagtgagttctgcaagtccagagttactatcaaagagaagccaaaagctcctgct
gctgctcccactccagctcctgcagtacctgcagctcctgaaccagttaagaaattggac
aatttgttcttcattgaggaacccaagagtgtccatatcactgagaagggcactgcgaca
tttatcgccaaggttggcggtgatcccattcctaatgtgaaatggatgaagggcaaatgg
aggcagatgactcatggtggtcgcattgccattgtgcagaaggaccaagacgccaagatg
gaaattagaaatgtgaccaaatctgacgctggacagtatagatgtgtagcatcaaacaaa
catggagaaatcgaatccagcactgatctgactgttgatgagaggaaagagattacacct
gaaatggtcacactgaagaagacaccctcaaaacagaaaagccccaaagaggacaaggac
attgatattgttgagctgctcagaaatgtggatcccaaagaatatgagaaatatgcacgc
atgtacggtatcacagattaccgtggccttcttcaagccattgaactgctaaagaaggag
aaagaagaagaacaaagtgcaagacctgaactggaacatacaagacgtgagtcagaagaa
gaagatctatcaaaacttgtggctgacttacagaagagaatggagcaaactgagcctgta
acactgatcagagacatcactgaccagactatagttgccaatagagaggctgtgtttgaa
tgtgagatcaaaatcaactacccagagataacactgtcctggtacaaaggcacccagaaa
cttgatacaagtgacaagtacgagattaaagttgttggtgaccgccacatcttaaagatc
aagaactgccagacccgagatgagggcagttatcgcgttgtatgtggaccacatatctcc
agtgccaaactgacagtgttggaaggtgaagtggaacagcacatggaggatgttgctggt
aaggaaggccaaacctgtacactcacatgccagttctccatacctaatgcaaaggctcag
tggtttaaaaatggaaagcttttagagcctcatggcaggttcacatattctgtggccaat
tacactcagaagctatcaattaaagatgttaggcctgaagaccaaggagaatatacctgc
aaatataaaaaccttgaaacaactgcaaatctttgggttgaagcggagcaaatacatttc
actaaacgcatccagaacattgtggttcgggaacgacagtctgcaacttttgaatgtgaa
gtgtcctttgacaatgcaattgtaacatggtacaaggacatatgggagcttaaagaaagc
ccaaagtacacattcaggagcgaaggccgacgacactttatgattatccgcaatgtaact
tcggcggatgaaggcgtatattcagtgattgtcagattggagcccagaggcgaagccaaa
agcacagcagagctttacctgtcagggaaagacattgatgtaggaagggtaccttatgat
attcctgactcgtcaatacaagtccctgaagcaccatctgcatttactgtcgaagctgaa
tcatctgttgaatactatcaatatgaagaaaagatggaaattcaagaatatgagtacaga
gcagaagaaaggatagtagaggaaatctctgttacagccccaagaattcctgtggaagag
attgttgagaggaaggcacttggagtgagagaagaagtaccaaccaaagttcctgagatg
gttgagaaaccagaggagaaacgtacaccagttgaggaaaagatagaagcacccgtaaaa
gtacccgaagctaagaaacctaaagaagaaaaagtcataccactcaaagtagaagaacca
aaagtacttcccactaaagaagaacgcgaagtggtacctgctccgcagccaaccaaagtt
gctcctgagaaagtgccagaagctgtagcacctgtggtttccaagcctaaacctaaagaa
cctacacctaaacctccatcagtacctgaaaccataccagagcccatgctgaaggccaaa
cctgagcctacacctgaaaagaagctagaaacaaagcctgaactgaagcctgtacctctg
aaggaaattgagccaactccagccaaagttcctttggagttaaagaaaccaaaaccaact
gaaccagaaccaccaagggcagtaccaaccaaaccagaaccagcacaagtcactgtggtt
cctaaggacatagtccctcaaaaagtacaagaaccttccaagaagccagaggttccctca
tatatacctgcagagaaagaggaagtgcaagaagaaatagcattgttcaggaaagaaatc
acacatatccctaaagtagaagaagacaaagaagaaaggaaaaagaaagctgttcctgac
cgcaaggatgtaacacctgtacctcaaatatctaaacccaaagttacacctgtcaccgag
tccatgttggaggccaagcccgagcttaagactgaacgtaaacctgagttcaaacctgaa
cctaaacttgatgttaagcctgagcccaaacctaaggtcaaacctgagccaaaacccgag
gtgaagccagagcccaaaccaaaggttatgcctgagcctaaacctgagatcaaacctgaa
cctaaacctgaggttaagccagagcccaaacctgaggttaagccagagcccaaacctgag
gttaagccagagcccaaacctaaggttaagccagagcccaaacctgaggttaagccagag
cccaaacctaaggttaagcctgagcctaaacctgagatcaaacctgaacctaaacctgag
gttaagccagagcccaaacctaaatttaagcctgagcctaaacctgagatcaaacctgaa
cctaaacctgaggttaaaccagagcccaaacctgaggttaaacctgaacttaaacctgag
gttaagcttgaacccaaacctaaggttatgtttgaacccaaacctgagattaaacctgaa
cctaaacctgaggttaagccagagcccaaacctggggtcaaacctgaacctaaacctgag
gttaagcctgaacccaaacctgcagttaagcctctgcctaaacctgaagtcaagccagag
aaacctgcacctgagaagaaacctgagtcgcttctaccaaaagttcatgtggaagaagag
aaaccaaagccaactcatcgcgaaccagcacaagcagtgcctactaaaccaaaaccagcc
actgtggttcctaaggaaatatctcttcaaaaagtgcctgaaccagagaagaaggctcct
tcagaaaagccagccattcctctgaaaaaggaggacgttgctcccaaagttgaaaagaaa
ccaactccagagcctgcaaagaaaatatctccagttgaagttaaaaaagaagcaccacca
gagcctgcagttgtgctggaagcaaagaaagttcctcctgttgaagttcaagagaagagg
aagaaggctgaagatcttaagaccatggagaagataacagagacaccagtacccacacca
ccagaacccagtatatcaaaaccaactgcaaaagaagatcagatacatcatgatcaacaa
cctaaagatggtgaaaaggaaccagttgctgcacctgcacccacacctgtgaaaaaaggg
aaaattcttattactgaggaagaaaagctagaaatgccgactctaaagaaagttacaagg
atctccaaagacaagcatgaggaacaagaaacagtgaaattgaagaaggtttacaaacct
tcaccagaagaacatgaagaaatcaagaaggtctatgctgaagctgccactgagatttta
attactgagagttatgaggctgaaaggcagtttgaaaaatatgaacgtatcaagagaact
gaaataataagacctgaaaaagacaaaataacatcagtggagcctgatgaagaaccagaa
aagacaaaaacagaggaagaaaaggtggaaaagccagacttgaagaaaatagcaaagatt
ccaaaacaagatgtgcccgaggagcctgacctggctttgaagaaaataaagaaattactg
cctgaaacaaaagaacaagaaacagtaaaattaaaaccttttgaaaaacctggaaaacca
gtgcctgaaccagcaaaagacactaaaatagaaccaacggaaaaagaacctgtatctttc
caaaaaggcagagaacctattagttttgagaaagctgaaaaaccccaaaaagctgatgag
caaaaagaaccggaggtcaccaagaaaacaacagagcctcctaagcctgacaagaagatg
ccagatgaggctgtacataaacccgttgatagagctaaaaaagatgaacaggcaaaagag
cctgatacaccattgtggaaaggcaaaaggatcccaaaacaagatgaggaacctgagaag
gttcagctaaagcctttcacaaagaagccttcagctggatcaccggaagaaaaagaagct
cctgaacccaaggaacgacagccaatagaaatatcaccacccagtcggatgtcaaagaca
gaactcttaaaggaaccaaaaactccacaaaaagaagttgaaattcctgaaaaagaagta
gaaaagaagccatctgtggtacctaaagaagaagaaaagaaggaatttcctaaaaaagta
actcctgtgaaaaaggaggtgactccaaagaaggaggatgagaagaagcctctagtgatc
aaaaagggcagtttgccaaaggagcctgagaaagaagaggttatacttaaacccattgaa
cttgcaaagaagggtttggagcctaaaaagtctccttcacccaaggtgactcaagcagaa
ccaactgaactagctccactggaaagaaagccaagtgtaggtgtggctaagaaaccactc
cctgaaaaggtttcccccaaagaatcaattgaaagtgttatcctgaaaaaagtgcctaag
aaaatttcaccccaggagaaaaagattgaagaaattcctacagtacctaagaaaatttca
ccccaggagaaaaagattgaagaaattcctgcagtacctaagaaaatttcaccccaggag
aaaaagattgaagaaattcctgcagtaaagggaagtgaagagattcccttaataaaagag
ctgtcccctggagttgtggagttaagaaaaatttcaacacaaatggaagaagaagcattt
gaagaggagatggctgaggttggagatgaggaggaagatgaggcatggggatgggagctt
tctcctcaagatagctatgcttctgaagacacagagtatttggaagaaggcgcacttgag
actgctgggataccaggaggtagacgagagggaaaaccaaaagaagaagccgcaaggggg
cggggactgaaaccaaaacaaactccatctcctggtgatgcaggacgtggaagaggactg
aaacctggtgctggtggtgacaaacctccaggacaatccccatttgaatacacgctaaag
gctgttcctctgaagtttgtaaaggagcttaaagacattgtgttgcaggaggctgagtct
attggttcctctgctgtgtttgagtgccagatttctccttctactgctgtaactacatgg
atgaaagatggaagcaacctaagggagggtccaaagtacaagtttacttctgatggaaaa
gaccgcaaactggctattgttgatgtccagctgtctgacacaggggaatacacatgcgtt
ggcaagcttggaaataaagagaagacctccactgccaaacttattgttgaagagttgcct
gtgagattcacaaagaacctggaagaggatgttgctgtaattaaggggcagcccatgtac
ttgacttgtgagttaagcaaagacagggatgtgatttggaagaagaatggagagccactt
tcagaaattgctggcaagattgccatcaatgttattggactgcaacgtgctgtaacaatc
caggatgcaaatgatgatgatgctggtgtttacacatgcgagtgtgaaaatctcaaaact
cagtccaatgttaaaatcattgaggtcatcagagactggttggtgaaaccactgagggac
cagcatgtgaaaccaaaggccactgctaccttcaagtgcgagctcttcaaagacactccc
aactggaagtggttcaagggaaatgaagagattccaaatgagcccacagataagactgaa
gtcaagaaggagggaaaagacatcactctgactattaagaatgctcaaccaaatgatgct
gatgagtatgccattgaagtggaaggccgtagatacacagcaaaactgacacttggagag
cgtgaagctgagatcctaaaaccccttgctagcgtggaagtggttgaaaaagaggaggcc
aattttgatactgaaatctcagaggatgatgtgcccggagaatggaaacttaaagggcag
gttctaacaagatcaccgacatgtgatatcagagcagagggaaagaagcgatttcttact
ttgaaaaatgttcagcttgatcaggcgggagaagtaacataccaagctctgaatgccatc
acatgtgcaatgcttacagtcaaagaaattgaaatggacttcatagtaccactgaaggat
gttactgtacctgaaaagaaacaagcaaagtttgagtgtaccatcactaaagatgtgtct
aaagttatgtggtatagaggatctgatattatatcatcagaccagaaatatgatatcatt
gatgatggaaagaaacacatgttggttataaaccactgtgaatttgatgatgagggagat
tacagtattgaggtcttaagcaaaacatcaaaagctaaactgacagtggagggtattaga
ctgaagtttatctcaccaatgtcggatcaaactgtgaaggaaggcaaaactgcttggttt
gaaattgagctttctcatgagaatgtgccagtgacttggtataaaaatgaaataaaactg
catccaagcagaacagtgcttacccatgttgatggaaagaaacatattttagaaatcaaa
gaagtcacactagatgatacttgccaaataacagcagaggctaaaggaatatcaactaca
gcaaacctgacagtactagagggagatgcctacttcacagttaaacttcaagactacaca
gcagttgagaaggatgaagtcactcttgactgtgagctgagcaaagatgttccagtcaag
tggttccataatgagatcgaaattaaggcttcaaagatggtttccatgaaggttgagggt
aaccgaagaatcctccacattaaaaaagtggagaacaaagacaagggccagtatgtatgt
gactgtggaacagacaaaacaatggccactgtgaacattgaagctcgtgacattaaggtt
gttcgtcccatgtatggtgttgagctgtatgatggtgaaactgcacgttttgaagtggaa
ctctcggaggatgatgtccatggccagtggaaattgaaaggagacgttctttctcagtca
ccggatgttgaaatcattgaggatggagctaagcacactttaactttatacaactgcaaa
gtgccccagtcaggtgaagtttctttccagggtgctaatgcaaagtgttctgcaaatctg
aaagtaaaagagcttcctattacattcctcacacctttgagcgatgtgcaagtatatgag
aaagatgaagcaaggtttgagtgtgagatatcacgagagccaaaagtcttcaggtggcta
aagggaacccaggagttgaaggcagatgacaaatttgacattctgacagagggaaaaagg
cacactcttgttgtcaaatctgctgcctatgaagatgaggctaaatacatgtttgaagct
gaggacaagaggacatctgccaaactcattattcaaggcattcgtcttgagttcatcaag
cctatcaaggatgttactgtaaaggagcgtgagacagcagaattcagcattgaactttct
catgagaaagttcaggtcacctggtacaaaaatgatgtgcgtttgcacccaagtaaagtg
gtgcacatgtctgaacatggcaagatccacaccctgtccttcaaggaggtgtccattgat
gatacctctttgatcaaagcagaggcccttggaaaaagctgtgaggcaatgctcacagta
cttgagggagaagcttatttcactaccaagctacaggactacacagcagttgagaaggat
gaagttgtgctgatatgtgaactgagcaaaccctctgctgaggtgaaatggttcaaggat
ggcaaggaaattaccccctccaaaaatatcctcatcaaggctgatggcaaaaaacgtatt
ctcacagttaagagggctgataagggaaatattggtcaatatacttgtgattgtggcact
gacaaaacaacagctaagctgaatattgaggatcgtgatattaaggttgtccggccactg
tacagcgtggaagttatagagactgagactgctcactttgagacagaaatctcagaggaa
gatgtccacggaaactggaaactcaaaggagaggctttgcaccagtcgccggactgtgat
attaaggaagaaggcaccagacacatgctgattctctacaatgtacgcaaagacatggct
ggtggtgtggacttcagtgctgccaatgctaaatctagcgctcagcttagagttaaagca
cgagtgataggcctcatgcggcctctcagggatgttacagttacggctggagagacggca
acttttgactgcgaactgtcatatgagggcatatctgtggagtggttccttgggggtaca
aagctggaaccaagcgacagagtggtgacccgagctgaaggcagaacccacacgctgacc
ctaagaaacgtaaaactgactgaagcgggagaggtgaaactaactgcaaaagatttccaa
atccaggccaacctcattgtaaaagagcctccagtcgagttcaccaagccgctcgaggac
cagactgtagaggaagaagctactgctatactagagtgtgaagtctccaaagaaaatgca
gaggtcaggtggtttagagatggacaagaaatccgtaaaactaagaagtatgagatggtt
gctgatggccggaagagaaagcttatcatccaagactgcacacttgatgactcaaagaca
tatacctgtgatgccaaagactttaagacttctgcttttctaaatgttgaacctccacat
gttgagttcactaaaccactccatgatgttgaggtaatggagaaagaaactgccaagttt
gagtgtgaggtttccagagaaaatgccaaggttcgctggttcaaggatggtaatgaaatc
aggaaaggcaagaaatatgatataatttccaaaggtgttcaacgcattctcatcattagc
aaggcagtgtttgatgatgaagctgaatatgaatgtgatgcaaggacctccaagacctct
ggcatgcttactgttgttgaggaggaggcaagattcacgaagaacctggctaatgttgag
ggcactgaaactgacagtattaaactgatctgtgaagtctccaagtccagcgcagaggtt
acatggtataaaggtgaccaggaattgcctgagggcggtagatatgaacatgttgcagat
gggagaaagagaatccttatcatccaggctcttcatatgaatgatgctggagaataccac
tgcaaattgcccagatcacaaactacaggaaacttgagaatcaatgaacttgctgctgag
ttcatctccagacctcaaagccaggaggtggttgaaggtgaaaaagctgagtttgtgtgc
tctgtgtccaaagattcttatgaagtcaaatggctcaggggtgacaaagaactccaaaca
gatgacaagtatgaaattacttctgagggcaaaagacgaggccttgtagtgaagaaatgt
gagctcagtgatgagggcccttttgtggctctcattggtgctacaagagcttctgctgat
ttgatcgtccttgagaaactcagaattatcacacccctcaaggacacaaaggcaagtgaa
ggacaagagatagttctcaactgtgaggtgaacacagaggaagccaaggccaagtggatg
aagaatgatgaaacaatatttgatagcagcaaatttatcatgacccagaaatacaatgtg
tactctttgagaattaaagatgctgacatgtcagatgcagctacttacactataacactg
actaatcaacggaatgaatgcgtcaagagctctgccaagattactgtacaggaggaggat
ctgaaaatcattgttcctctggaggatgtcgaaacacaagagaagaagaccatcagcttc
tcatgcaaagtaaacaaactaaatgtgactgtgcagtggatgaaggcaggacaggagatt
actctcagcaagcgcgttgtgtatcgtgttgacaaggacaagcacaccttgaccattaaa
gactgtagtctggcagatgaaggggagtactttgtcattgctggtgctgacaagtcatct
gctgagttgattatcagtgaagcacctactgactttatcatccaacttcaagaccagacc
attaccgaatttgaagatgctgaatttacctgccaactctctaaagaaaaggctgaaatc
aaatggtacagagatggcagagagatcagagagggtccacgatatcaatttgatcgtgac
ggaaagacctgcacactacgcattaaggagtgcagacttgatgatgaatgtgaatatgcc
tgtggtgtagatgacaaaaaatcaagggctcgtctctttgttgaagaaacaccagtggag
attatcagaccacccaacgatatatttgagcctcctggctctgatgttgtgtacgaggtc
gagctcaacaaagacagagttgaagtcaaatggctaaggaacaatatgactattgtccaa
ggtgacaaataccaaatgatgagtgaaggcaagattcacagacttcaagtatgtgaaatt
agacctcgtgaccagggagagtacagagttattgctaaagacaaggatgcaaaagccaag
cttgagcttgcagctgtgccaaagattaagacaatggatcaggaactggtgacagatgct
ggaaaaccatttgtcatgtcagttccctacaatgcctacccacatgctgaggctgaatgg
ttctttgacaacattagtctgcctaaagaaaatcttcataccatgccagacaaagcagag
taccggctgaaggaccccaagaagtcagatgagggccgttacaagatcgttattaagaac
aagcatggagagggagaggctttcattaatctcaaagttattgatgttcctggccctgtg
aagaacctgcatgtggttgatactgctgatggagaggtcagcattgcatgggatgagcct
gaaagtgatggtggcagcaagatcttagcctatgtggtggagagacgtgatgtcaagcgc
aaaacctggactctggcgactgatagtgctgataccacagagtacactgtcactgggcta
cagaaagactccaagtacttttttcgtgtttgtgcacgcaacagagttggaagcggtccg
aatgttgaaacagatgaagctgtgcaagctaagaataagtttgatgttcctgatgcacct
caaaatgtcactgttggaaatgtaaacaagtttggtgccacggtctcctgggaaccacct
ctgtttgatggtggatctgaaatcacatcctatatcattgaactccgtgacagaacatct
gtgaaatggtctccagtcatggtgactaaagcacaagatcgttcagctataatcaatgat
gttattgaaaacaaggaatacatcttccgtgtaagagcagaaaacaaggctggtcctggc
aaaccaagtgctgccactaacccagttaaaatcatggacccaatagagagaccaagccca
cccctgaatctgacacactctgaacagaccaaggatgcctgtctgctgacatgggagact
cctcttagaaacggaggcagcatgatcactggctatattattgaaagatgtgaggaagat
tcagacaagtggctgagatgtaatgccaggctttgccaggacctctcatacaggatgtct
ggtcttaaatttggaaagaattataagtacagagtcattgctgagaatgcagctggtcag
tctgacccatctaatactgttggacctgtgctggcagatgacccacactttgcacctaca
ctggacttgagtgcctttaaggatggcctggaggtcattgtacctcagcctcttactatt
cgtgttcccatcactggatacccgacacccactgctaagtggacctttggtgacaaggag
ctcacttctggcgaccgagtgtccatggtcacaaagagcacgttcacagagttagtcatt
actccaagtgtgcggcctgataaaggcacatattctctgacgctggagaatgatgtaagc
agtgtctctggagagattgacgtcaatgtcattgcatgtccaagtgcacccaaggacttc
aaggttgcagaagtaaccagaaaacatgtgcatcttatgtgggacccaccagaccatgat
ggaggcagtccactgactggctaccaggttgagaagcgtgacgtgtccagaaagacatgg
gtcaaggtcattagtggtgtgcaagaccaggaatacactatcacagatgtgattgagggc
aaggaatacttgtttagagttattgcctgcaacaagtgtggccctggagagcctgcatac
attgacgaacctgttaatgtgtcttcaccagccactgttccagatccaccagagaatctt
aaatggagagacaagacatccagcaaaatattcctttcttgggaacctccgaaatgggat
ggcggtgctccaataaaaggctacactgttgacaaatgccaacgtggcactgacaagtgg
gagccatgtggagacccaacacctgagctcaagcttgaggttactggtctgatagaggga
cagtggtatgcttatcgtgtgagagccttgaacagactgggctcaggtagacctagtaag
gcaaccgatgagatcttggctgttgatcctaaagagcctccagaaattcacttggatgca
aaactcctggcaggattaactgcaaaggctggctcaaagatcgaacttcctgctgacatc
acaggcaaaccagaacctaaagtcaaatggaccaaggctgacctcatccttaaggaagat
gacagaatatctattgattccaagcctggtcactccacagtgtcaattgctaagacaaaa
agggatgactctgcaacatacatcattgaagcagttaacagcatgggccgtgcaactgca
actgttgacgtcaacattctagataaacctggccctccagcttccttcgatatctctgaa
atcaccaacgaatcctgtttactggcctggaatccacccagagatgatggtggctcaaag
gtgacaaactacattgttgaaagaagggctacagacagtgaaatctggtacaagctgtct
tctactgtgaagcagaccaactacaaagccaccaagcttgtgactttaaaagagtatatc
tttagagtctatgctgagaatcaatttggcattggtccaccagctgaacatgctccaatt
attgcgagatatccctttgatccacctggacctccatacaaactggaggcatcagatatt
gctaaggatgctgtaactctgacctggtatgagcctgatgaagatggaggaagtcccatc
actggctactgggttgagagatttgaaccggatgttgataagtggataagatgcaataaa
atgccagtcagagacactaacttgagggtaaaagggttgcccacaaggaagaagtacaag
ttccgtgtcttggctgaaaatcttgctggactaggcaaaccaagcaaagagactgaccac
atcatgatcaaggatcctattgatcctccatggcctccaggcaagccaagtgttaaggat
gtagcaaagacatctgctttcctgcaatggacaaagcctgaacatgatggtggtgctaag
attgagtcctacattattgagcttctcaagagtggaactgatgagtgggttcgtgtggca
gatggtataccttctgttgaatattttctgaagggattaatggagaagcaggaatactcc
ttccgtgtcagagctgtcaatgcagcaggcgagagtgaacctagtgaacctagcaatcct
gttctttgcaaggagagactcaatcctccatcaccaccaagatggctagaggtggttagt
atttcccgtaacaatgccgaactaaagtggacagccccagagagagatggtggttctcca
attaccaattatattgtggaaaagagagatgtgagacgcaagggctggcaggctgtggat
actacagtgaaggagctgaactatactgtcactccactgaatgaaggctctctctatgta
ttccgtgtggcagctgagaatgctgttggacctagtgaatactgtgaacttgtagactca
gttctggcaaaagacacattcactactcctggacctccttatgctctaactgtcacagat
gtgtcaaagacacatgttgatcttaaatgggaggcacctaagaatgatggtggtagacct
atcttacggtatgtcattgagaagaaagagaaacttggaactcgctgggtgaaatctgga
aagacatcaggtcctgactgcaagtacagggtcactgatgtcattgaaggcactgaggta
cagttccaggtcctcgctgagaatgaggctggggttggtcacccaagtgaacctacagac
attgtggtaattgaggacccaacaggtccaccatcacctcctcaggatctccatgtcacc
gaggcagccagggaccatatctctattgcgtggaaagctccagaaagaaatggaggaagt
ccagtcactggatatcacattgagctctgtgaggctggaacagaaaagtggatgagagtt
aactctcgtccagttaaagagctgaaatacaaggctggggaggaggaaggcattgttcct
gaaaagaagtacattttcagagtccgtgctgtcaattccattggtgctagcgagccatct
gatatctctgagagtgtatatgctaaagactctgactgcaacccaactattgagttccag
accaaggatgttgttgctgtggagggtgagaggatgcacctcccaattccatttagggct
gttccatcacctaggatcacatggcacaaagatggcaaggagatgaaggctgatgagaga
atttcattcagatcagattacacttcctgccacctggaaattccaagctgtctgcatgct
gatgctggacaatacaaagttaccctggagaacagccttggagcaatcagcgggacaatt
aatgttaaagttattggacttcctgggccatgcaaggaaattgttgctagtgatatcacc
aagaactcctgcaaagtgacatgggaacccccagactatgatggtggcagtcctatcctg
cactatgtcctgcagcgcagagaagcaggcaggagaacgtatatcaatgtgatgtctggt
gagaacaaactgagctggcctgtcaaggacctcatccaaaacggagagtactatttccgt
gtcggagcggtgaataaaattggtggtggcgagtttattgagcttcgcaatcctgtaatt
gctgaggatcagaagcatccacctgatccacctgttgatgttgagactcacaaccctact
tctgaatctgtgacccttacttggaagccacccatgtatgatggtggatgcaagatcatg
ggttacattctagagaagaagatgaaaggtgaagaaaaatttgagagatgcaatgacttc
cttgtgccagtattgtcctacacggttaagggcttaaggccaggaaaagagtatcagttc
caagtgcgtgcagagaatgcagcaggcattagcgagccttctcgtaacactcctatggtc
aaagccactgatgcagttgatcgccccaaggttttcctcagtggcagtttgcagtcaggc
ttaagtgtcaagagaggtgacgagatccgactgactgcctatatttctggttttccttac
ccggaaataacatggatgaggaacaagtcaaccatcaggccagaagcactgaagaagagg
ccagaaaagcctgttagaaagaagaaggaaaagaaggcagaggaagcaaaaatagaagaa
gacaaggagaaaaaggaggagatgaaaaaggaagagcaggacaagaaagaggaagagaag
aaggagaaactaaaggaggtagaggaacctgaagagccagaggaggaataccacccatct
ttgaatgagcgtcttagcattgataactcaaggaagggtgaatcctccattcttgtgaaa
gatactatcagaggcgatcatggtgttttcaccatcaaagtggagaatgatcatggtgtt
gcctctgccacctgtgaagttattgttcttgatactcctggacctccagtcaacttcaga
tttgaagaagtcaggaaggattctatcctctgcaagtgggaacctcctctagatgatggt
ggcagtgaggtcctaaattatgtattggagaagaaagataactccaaagctgatacagga
tgggtcactgtgacatctactcttagaggttgcaagtacccagtgacaaaactgattgaa
ggaaaggagtatattttcagagttactgctgagaacagatttggtcctggaaaaccatat
atctccaaacctgtcattgccaagaatccatttgatccccccgaggcacctgagaaacct
gaaattatggacattacagctaacagcatggttgttacttggaatgaacccaatgacaat
gggagccccatccaaggatactgggtggaaaaacgagaaattaacagtacacactgggca
cgagttaatcgcaacatcattgatgcgctggaagtaaaagtagaaggtcttttggaagga
ttgacatacattttcagggtctgtgcagaaaatgtagctggatgtggaaagttcagtcca
ccatctgatccaaaaacagcccaggctcctatcttgccaccgggtccaccaattccacgc
attgttgacaccacagaccattcaataatagttgaatgggaccctccagcagacaatggt
ggtgcagacatttttggttaccatgttgacaaggtaattgctggcactaaagactggtca
cgagccacagagagaccatggaagaaccacacatttactgtgtatggtgtcagagaagga
gctaagtacattgtccgtgtggtggcagtcaactctgctggtgaaggtgctcctggtatg
acagatgctgtcattgtgaggaatccagcagagatgcctgtaattgaacttgatatctct
gtgaagaatggtcttgttgtaagagctggagagatgctgaagatccctgcacatgtaatg
ggtaaaccaaaaccatcacttacatggacaaaggatgatgtggctcctgacaaagagcgt
gtggaaatagaagaagtaggacaggacagcactgtcatcattaagacctcaaaaagaagt
gacagtggcaaataccagatcactgcagcaaacccaagtggtataaaatctgcatggacc
agggttgaagttgtggatgttcctgggcccgtccttgacctcaagcctgtagtagtaacc
agaaagttaatgattctgaactggtccgatcctgacgatgacggtggaagtgatttgact
ggcttcactgtcgaaagaagagagccaaagatgcacacatggagacagcccattgaaaca
gctgcatccaaatgtgaaattgtaggtattattgaaggacaggagtacatattcagagtt
gtggccaagaataaatatggctgtggaccaccagttgatcttggacctattcgtgcagtt
gatccacaaggtccaccatcctctcctgagaagtttcactacacagaaagaactaagtca
tccattacccttacatggaagccacctcgcaatgatggtggtagtccaattattggctac
atcattgaaaagaaacgtcaagatcagcctgctttccagcctgtctccaaagacttgtgc
actgctctgacactgactgtggagaatctggatgagctgcacatgtatgagttccgtgca
aaggctgttaattgcattgctgaaagtgatccttctatacccttgactgttgtgattcag
gatgatgaagttcctccaactttgcacatgatgaagcacttcaaaggtgacttgattaga
gtgaggaagaatgagccagttgagattcctgctgaaatcacaggtctcccaatgccaaag
gttgaatggttgaaagatgatgttgttatagtaaagcccactgagagaatcctgtttgag
accaaagtgattgacagactcacagaacacactaaacttactatcccagctattgcaagg
ctggaaaagggaacatacactgtgagtgcctcaaatcgccttgggtcagccagccattcc
atcacagtggaggtgctggatcgaccaacaccaccaagaaatgttgcagtttcaaatatc
cgagccacgtcttgccagctgacctgggatgcaccactggatactggtggcagtgagctc
accaactacattgttgagaagaaagaccttaatgttgaagatgttgagaaagctgaatgg
gttcaggttactaataccatcatagagaaaaaatatggggcatgggaccttgtaactggt
ggaaactatatgttcagagttaaagctgagaataagtatggaataagtgatggctgtgaa
acagaggaagtgcaaataaaggatccatttgccctacctggtccgccagaaaaagttgct
atagcagaacattctaaagcccatatgctagtaacatgggagcctcctatggattgtggt
ggatctatgatcaatggctattggctagagaagcgtgaaaaaggcaccacctactgggct
aaagtaaacaagaccctggtgtcaaaacgtggaatgaaaggctgggaatttctggtcacg
cgtctcattgagggaactgagtatgaattccgagtgatggcttgcaatgctgcaggagtt
ggccctccaagcgctgtctctgaatcagcctttgctattgatcctctcgctccacctggc
atgccagcagctcctgtagttgctgacaaaaccaagcgtagtgtcactctgtcatggacc
ccaccagccaaagatggtggcagcccaatcaaaggttacataattgaaatccaggatgag
ggaacatctgattgggcaagggtgaatgatgcagacaatctacaccctactactgaattt
accgttcccaatctccaggaactcaagaaatacagatttagaattattgcagtaaatgat
aatggcgagtctgagccaagtcctagaaccacagaagtgctcatggaggacattcacact
gagccaaagatatttatggacatcagtgctgatgaattattatgtatccgtgctggatca
ccaatcaaaatcccggtaactattactgggcgtcctgttcccaaggttacttgggaattt
gatggcaaagcaaagacagagaagaaagatcgtcttcatatcctacctgttgattcacag
gtggaatctactgacactacctctgttgtaacaattccagtgagcttgagagctcactct
ggcagatatactgtcacagcaaagaacaaaactgggcagaaacatattaatatcagagtc
attgtgcttgatgttcctggagcacctaaggatctcaaagttactgatatcaccagatct
acaatgcggattatctggaaactcccagatactgatggtggagagaggattaagagctac
tttattgaaaagaaggctgtcagtggaaaggcctggacaacagtaaatgcagcctgtgcc
aatatggcctttgtggtgcccgaccttcttgagggccaggaatacctgttccgagttcgt
gctgagaatcgtcttggaatgggaccattcactgaaaccacagagccagcaagggcaagg
gatcccatttatcctcctgatcctccaactaaggtcaagataaaccttgtcaccaagaac
acagtgactctaacatggatgcctcccaaaaataatggtggcgcaccagtaacacattac
attattgagaggctgagctgggacaccagtggtccacaaaaggagacctggaaacagtgc
aataaaagggatgttgaagagacaacttttattgttgaagaccttaaagagggtggtgaa
tatgagttccgtgtcaaagcagtgaatgaagctggtccaagcagaccctctggtactgtt
ggaccaataattatcaaggaccagacttgtgctccaatcatcgatcttagagaatctctg
gagagtgcagaaacatttgatgttaatatacttgccaggatccagggttgtccattccca
tcactcgtttggcaaaaagccacatctgacaagcctgatgaaaagtttgatgtacaatat
gatcagcatatcaataaacttgtctctgatgacaaatgcagtctggtaattcagcaatcc
aagagagatgacagtggaatttatacactcacagctactaacagccttggcaaggcttcc
aaggatatcaaacttaccattttgggacgacccgggccaccagttggaccagtcaaaatt
gaggaagtttttgctgaaaggattggactctcctggaagccacccacagatgacggtggt
tccaaaatcacaaactatgtcattgagaagcgtgaggacaacagaaagacatgggtacat
gtatctagtgatcctaaggaatgtgcatatacagttcaaaggctaacagaagggcatgaa
tatgagttccgtattatggctcagaacaaatacggtgttggaccaccactgtatagtgag
cctgagaaagcaagaaaccttttcactgtccccggtcaatgtaacaagccaactgtctca
gaagtctctcttgaatcaatgactgttgaatgggaggagccagaatatgatggtggatct
ccagttactggttattggctggagaagaaggaaactacatcaaaacgttggactaaagtg
aaccgtgaccccattagaatcaggccccttggtgtttcacatgttgtgactggtcttttg
gaaggagctacctaccagttccgtgttattgccattaatgctgctggatgtggacttcca
agtctgccatcagatcctgttgtttctagagatccaattgctcctccaggacccccgatg
ccaaaggtaacagactgcactaagtcaactgtagatcttgaatggattcctccactgatt
gatggtggatctaagatcacaggatactttgttgaatacaaagaagaaggaaaggaggaa
tgggagaaggctaaagacaaggagattagaggcactaagtttgttgttcctggactcaga
gagcttggactttacagattcagagtaagagcagtgaatgctgcaggagttggtgaacct
ggtgaagtcacggaagtgattgaggtcaaggatagaacaattcctcctgaagtggatctg
gatgcaactgtaaaggagaagatcactgttcatgctggtggcgtaatccgtattattgct
tatgtatctggcaaacctgccccagaaattatctggaacaaagatgatggtgatatgcct
aaagaggctgttgttgagaccactgctatcagctcttctctggtcatcaaaaattgcaaa
agaaatcaacaaggtatttacaccttgactgccaagaatgaaggaggagaaaggaagaag
gcagtaattgtggaagtgctggatgttcctggacctgtcggtcagcctttctctggtaca
aatctgactactgactcttgcaagctgacatggtattcacctgaggataatggtggctca
gccatcaccaattacataatagaaaaaagagaatctgaccgcagaggttggacttcggta
acatacaccgtgaccagacataatgctgtggttcagggtcttattgatggcaaaggttac
ttcttcagaattgctgctgaaaatataattggaaggggcccatttattgagactgcatca
gaagttcttattaaggatcctatttctgtccctgagcgtccagaggatctggaggtaaca
gctgtcacgaaagattcaattagcttagcatggagaccaccaaagtatgatggtggtgca
gaagtgacaagctatgttcttgaagtccgtcagataggaaaggacaactttacccgtgtt
gcaactgacagcaagctaatggatcgtaaatttgttcatgagggtctcaaagagggctct
acatatgaattccgtgtcagtgccgtaaatcagattggccaaggcaagccgtcattcagc
actaaacctattacatgcaaggatgagcttgagccacctacccttgatctggaattccgt
gacgcacttttagttcgtgttgggcagccctgcactctccaaggtcgttataaagggaaa
ccaacgccaacaatcaaatggtttaaaaatgatgaggaacttcaagcaaatgatgagatt
atgctcaccagcactaagaagaccttgtgcttgtctattgaaaaggctaagcgtgatcac
agtggtaaatacactgtggttgtggagaactcaactggcacacaaaagggcatctgcatt
gttactgttgttgatcgaccacagcctccagagggccctgtcgtctttgaagaaatcttt
agggatcacatggtcatctcttggaaaccaccactggatgatggtggatgtgctgtatct
aattacattgttgaaaagagagatagcaacagggatctctggatgcctgtcacagtgtcc
tgcactagaacaacatgtacagtacccaaactaattgagggcagagaatacattattaga
atctgtgctcagaacattcatggcataagtgatccattgctgtctgctgagacaaaagca
agagatgttttcaaggtgcctgatgctcctaagcagccattggtgaaagaggtctacaaa
gacacagctctgatttcctgggaaccaccagctgatggtggaaaaccaatcacaaactac
attgtcgagaagagagaaacaatgtcaaacagatgggttcgtgctggaactgaacgcatc
ttccctaaaacagaatactgggttccagatcttctcaaaggatgtgaatatgagttccgg
gttatggcagagaacgtcattggtgttggtgatcccagcccaccctcaaagcctgtcttt
gctaaagatcccattgtgattccaagcccaccagtaaagccaatggcaattgacaaaaca
aagaactcggtcactctatcttgggagccaccaaaggactgtggcagaggcaaaatcttg
ggctacctgcttgagtaccagaaacctggagaggaggaatggatacaggttaatcagact
cctgagtcctgcccagaaacaacattcaaaatagtcaaccttgaagatggaatgttatac
cggtttagagtgaaagcagtgaatgcagctggggaatctgatcctgcaaatgttcctgag
cctattcgggcacaagacagacttgagcctccagagcttctgctggatatgggcatgcct
cgtgagcttaaagccatggcaggaactcatataaaaattgttgctggaatcaagggtatg
cctttccccaaggtcacatggaagaaaaatgatactgaggtacctccaagagcagaaatt
gagacttctggagtaagaaccaagcttgagatgcgctattgtaaccgaggggattgtgga
gactacacactcactgtagaaaacccagctggatccaagacagcaacatgcactgtgctt
gttttagataaacctggcccaattcaaaatctgagggtatctgatgttagaagtgactca
gctcaactctcctggaaagatccagaagataatggtggtgtacgcatcaccaactttgtg
gtggagaagaaggatgttgcttctgcacaatgggtgccagtctgtgcaacatccaaaaaa
cgaagcataatggccaagcatttgatggaaggcacatcatacatgttccgtgtggctgcc
gaaaatcagttcggcagaagtgaatatgttgagacaactaaacctgtgaaggcaatgaac
ccactgttcccacctggtccaccaaaggacctgcatcatgtagatgttgacaaaacagag
gtgtggcttgagtggaactggccagatcgcacaggaggaagtgacatcactggattcttg
gtggaatatcaggaggagggtgagagagactggatcgtcttcaagactgtgagcatccct
gaatgccatgtgacagggctggaggagggaaaaacctatagattccgtgtgaaggcagag
aatgcaattggtcttggccgaccagacaccactgtgccagtgctctgccaagaaaaactt
gtgccaccaattgttgaggttgatgcaaaactgattgatggaatcattgtgaaggctgga
agcactatcaggctgcctgcaatcatgagaggcattccagttccgactgcaaaatgggtc
attgatggcgaagaaattaaaagcgaaggaaataccaagattgacacagacaacttttcg
actattctgagcattgctgaatgcacaagaaatcacactggaaactatattctcacagta
tctaaccctgcaggaagtaagactgtttctctgaatgtcacagtacttgatgtccctgct
gcgcccattggcccagttaacatccttgaagtaactccagattccatggtcattgactgg
cgtcctcccaaagatgatggtggaagccctgtcacgaattatattgttgaaaagaaagaa
tctaataaggaaacttggggaggtgttagctctggcagtactgcgacacgacttaagatt
tcccgtttacagagtggtgttgaatatgttgtaagaatccgtgcagaaaacaagatggga
attggtgcacctcttgaaagtgcaccaactgtggcaaagcaccagtatgagccacctggc
catcctggaaaacctgttgcatctgatatttctgaggatgcacttactcttggttggaca
atgccattgtatgatggtggcagtcctattactggttacattatcgagcggagacataaa
ggaggcaaatggattcgagtgaataaaataccatgcaaggacctccgattcagagtgctt
ggactttttgagggtaatgattatgagtttagagtatttgctgaaaatattgctggcttt
agtggaccgtcacctatctcagacccagccaaaccctgcaggccaattacagttcctgga
ccaccagtcaatcctaaagttaaggattatagctgcacttatgctgatttagtctggata
aagcctacaagagatggtggtagcccaatcctgggatatgttgttgaatggcagaaagct
ggtggtgaatgggataaagttaacaaagatgatttgattaaacaatgtgcatatagagtg
aagggactaactgaaggcacagaatataggttccgtattcgagcagtcaacatgattgga
gatggtgagacaagagaaatcccagaatcagttattgctcaagatattctcattccccca
gagattgaaatggatgtcacatgccgtacacatgtgactgtacgtgtaggacacaatatt
aatattactggatatgtgaaggcaagaccagatcctgagattatttggaccagaggagag
actgttttggaaagagataaacgtactactctctcaaaaaatttccctgttgtacatatg
cgtatcaaggaagctatcagagcagatcatggaaagtatgttcttaaggctgtgaatgat
ggtggagaagcctcagctaccatcactgtaactgtactggacagacctggaccctgcagg
aatcttaaattaacatatgtgaccaaaaattcttgcatggtgaactgggatgctcctgag
gacaatggaggcactgagattacaaactacattgttgagtgtcgcgagccaagcagcaga
acatggtcaatgatctcgtctgactgcaccaaccgcaaggtaaaagcaaaactcctggag
aatcatgaatatttgttccgtgtatctgcagagaacaagtgtggtcctggacaagcaata
gaaaccaaaacacctatacttgcaattgatccacttcagagacctggtgaaccagaaaat
ttccatgtagctgatgttggcaagaactttgttttcctgagatggcgaagaccagattat
gatggtggcagtccaaacttaggctacattctggaaaagaaagcaaaggatgctgaagag
tgggaaagcttacatgatggcataatcaaagacacattctttatggcagacaaatgtgct
gagaatcaaatatatcaatttagagttcaggcaacaaatgatggtggagaaagcaactgg
gtgaagacatctgatgttcttgtcaaagaagaaattcagaaaccagttcttgacctcaaa
tttgctggtactatagtggttaaagctggtgaatcagtcaggcttgaggcagccctcaga
ggaaagccacaacctgaggtaaaatgggtgaaggacaaggctacagaagataacccaaga
gtcaccattgacactggagcagattattcaaaattccttatgactaaagccaaacgatct
gacactggaaaatatgtaataactgccacaaactctgctggaagtttcactgcatatgca
aatataagtgttttggacataccaggacctgtcagggatgtcagggtcactagtgtgtcc
acagacaaatgcagagttgtgtgggatcctccagaggatgatggtggttgtgaagtcaat
agctatattctagaaaaatgtgaaactagaagaatggtttggtctacatattctgataat
gtagtcactacctactgtaatgtgactcaccttgttgaaggtaatgagtacatctttagg
gttagagcagaaaacaagatgggaacaggtcctccaatggagagcaagcctgttattgcc
aaaacacagtacagcagacctggtccacctgatccaccagaggtcaccaaaattggcaag
gatgagatgactgtgatatgggctcctcccgagaatgatggtggaaaatccattaccggc
tacatcctagaaagaaaggagaagcgtgctgtacgatgggtaccggttacgaaaagtccc
atctctgagaggcgcatgagagtaaccaacttgattcctaaccatgaatatcaatatcgt
gttaaagctgaaaatgaggttggattaggagaaccaagcaaaccttcaagaccagttgct
gctaaggatccaattgagcctcctggtcctcctgccaatctgaaagtggtggacagtaca
aagacttcaattacacttggctggtccaagccagtgtatgacggtggtgccccaatcatt
ggatatttggttgaaatgagagagaagattgaaatggaaggtgaaaaagagcgagatcca
gaagaaggctggtcaaaatgcaacactagtgggcagcttgttctcactgaattcacaatg
ctcaacttggatgagaggaaacaatatgaattccgtgtctctgcacaaaatcaagttgga
atgggtcgcccagcaaaacttaaagatgctgtgacaccaaaagagattcatgaattgcca
gagattgatctggatgccagtttgagaaaaggactcagtgtaagagcaggttgtcccata
agactatttgctacaatcagaggaaggccatcacccaaagtgacctggaaacgcattggt
attgacaatgttgtcaggagaggtcatgtggaccagattgatacaatgacctttcttgtt
atacctgagagcacacgtgaagactctggaaaatactctctgacactctcaaatccttca
ggagagaaagctgtatttgttcgtgttaaggtcttggatactcctggacctgttggtgaa
ctggaagcaactgatgtcacaaagacatcttgccaactctcctggtcacctccagaaaat
gatggtggcagtccaatccttaactaccttgttgagaaacgtgaagtagataggaaaaca
tggacaaattgcaccaacgacttaaagaaaacaagctttaaaatcacaaacctaacaccg
ggaactgaatactacttcagggtcatggcagtcaacaagtatggtattggggtgccaaaa
gactctccaaaatcctatttggctgtagatcccatgagtgaaccagatcctcccaaaaag
atggatgtcttggagatttcgaagaacagtgcaaaacttggatggctaaaaccactgaga
gatggaggatctaagattaatggctacattgttgattaccaggaggctggtcaacctgag
gacaaatggacatcatactcagttgtaaaggacttgagcattgtggttgttggtctaaaa
gaaaacacgaagtatagattcagggttgctgcaagaaactctataggatgcagcctgcca
agagaggctgaaggaatttttgaagtcaaagagcacctgatggcaccaaagattatcatg
cctgatgtagtcacagcaaaggcaggaacaaagctgaatgtcgaagcacttgtatctggc
aaacctgttccagtcacgacatggaaaagaggaagtgatgatgtggtaacatctgatcgt
ctttctgtgcaaaaaacgttgtcctcatccacactaatgattaaggatgtttcaaggaag
gacagtggttattacagtcttactgctgagaacagcatttctaaggtcaaccaaatcctc
agaattataatcatggatatccctggtcccccagaggggcccctggaaattcttgagatg
gacattgatgcctgcactcttgcatggaactcaccaactgaggatggtggtagcaacatc
actaattatgttgttgaaaaatgtgacgtgagcagaggtgactgggtccctgctgtagcc
tcttgcaccaagaccagttgccgagtggtaaaacttacccctggcaaagaatatggtttc
cgagtgcgtgctgaaaatcgctttgggatttcagagccaatctactccgaaaaaatgatt
gccagatatccatttgatccacccagtgaaccaaggaactgctgtgtcaataaaatcaac
aaggactttgttgttttgtcttgggagagaccagtaaatgatggtggtagtcctattata
ggatactcaattgaacgtaaagagagaaacagccttttatgggtcaaggcaaatgagaca
cttgttcgtccaactgaatactcctgctctggccttattgagggtctggaatacacattc
agggtatctgctgtgaataaagcaggacaaagcaaaccaagcaaacctactgagatcatt
acagccaggacccccgttgatccacctggtaaaccagaggttcttgacgtgacaagaaat
tcagtttcccttgtttggaaccgtccaaaacatgatggtggtagcaaacttattggttat
tatgttgagtgtttgaagcttccaggggacaagtgggtacgtataaatgcaagcagccaa
aatgtgccaaaagaggaatacattgccactggacttgaagagggagcccaatacaagttc
agaataattgcaaagacagcaattaacatcagcgaaccttcagaagagtctgatgcaatc
acagtcattgcagagcatgttccacccagggttgagatcagtcttgaaatgaagaacctt
atcactgtcaaagctggagcaaatgtttgcctttatgctgaggtctatggaaaaccatta
ccaaaagtttcatggaagagagatggtgtgccattgtcacttgttgagggcatgaagatg
tctcagaagagacacctcttcctcttagaattgttctctgtgacaagaaaggagtctgga
gagtatactattgttgctgagaaccctagtggcactaagtctggcaacattaagctgaag
gttctggataaacctggacccccagcatcagtaaagatcagccaagtttttgctgaccgg
gttaaactgcggtgggagccacctctttcagatggtggagctgaaataaccaactatatt
attgataaacgtgaaacaagcagagctaactgggctcaggttacttccaacattaatggc
cagattacaaactgctcagtggagaaattgattgagggtcatgaatacgagttccgcatc
agtgctgaaaacaagtatggtgttggtgacccaattgtcactacctctgtgattgctaag
aatccatatgatgttcccggaccttgtgacccacctgttattaccaatgttaccaaagac
cacatgactgtgagctggaaggcccctgctgatgatggcaaatccccaatccttggatac
atggtggaaaaacgtgaaattcaggaactcagttggtctaaaataaacagaaaacctgtc
attgatagaacaattaaagctggaggtctcactgagggttctgagtatgaattcagagtt
attgctctcaataaggctggtcttggcaaaccaagcgatccctctcaagctgctcttgca
gtggacccactatatcctccagggccacctgctttccccaaggttgttgattctacacac
agctcagtcagtctatcatggaccaagcctgcctatgatggtggatgtgaaattttgggc
tacctggttgaggtcaagagggcagattcagaggactggttaaagtgcaatatgccaaaa
aatctccaggacacaaagttccttgtcagtgggctccttgataacacagaatatcaattc
cgtgtgactgctgtaaataagattggatttagtgagccaagtgaagttcctgggaagcat
atggcacaagatattttaattgctcctgaggcagaccttgatgcagatcttaggaaagca
cttgtattgcgagctggagtcacactgagaatctatgtgccaattagaggccgtcctgca
ccaaaggtgacatggagcaaggtcaatgccaacttgaaggagaggcaaggtcttatgatc
aacacaaccgaatgggatacttttgtatactgtgaagacatcaacagatatgatgctggc
aaatatgtgctaacccttgaaaacagcagtggatccaagtcctataccattgttgtcaaa
gtcttagatacacctggaccaccactcaacctgactgtaaaagaaacatcaagaaatcat
gcatctatcacttggcatcctccacaaattgatggtggaagtccagtgaagagctatgtt
gtggaaaaacgtctggcagaacggaaagcatggacctgtgttgcttctgagtgccccaaa
acatctttcagaattactaacctagatgctgggaaagcctactgtttcagagtctcagct
gaaaatgtgtatggtattggtgaaggctgtgagacagctggaccagttaaagcctcagag
caacctggaccagttacagaattcaaacctgcactggtcaccaaggattcttgcacactt
atttggaagaagcccatcagtgatggtggaagcaatattgttgcatatgcattagaaatc
agtgaaggtgaagacaaatggaagcagctcatgaaggccaaacaactgcaatacacagta
aaggacctacaagaaggaaaagaatactctttcagagttaaagcttataatgagtctgct
gaaggacccaccactgaactgactgtggtggctaaggatcaaattgttctcccagactgt
gaccttaaggggttgccagactcttgttatgtggcaaaggagggaagcacggttcgcctc
acaatcccaattactggtattcctgctccaacagtcatgtggaagaagggaggtgttgct
ttgggagatagtggaagagtctctgttgaatccacagtaacaaacacaaccttgctgata
cgtgactgtcagagaggtgatgcagagaagtattgtctcattttgaaaaacagtgcagga
accaaggaaggcaccatagacatcaaggtagttgggaagcctggaatttgcacagcgccc
atcaaatttgatgaaattacagctgatggaattactttggaatggggtccacccaaggat
gatggtggatcagaaatttccaactacatcttagagaagaggcagtccacaaataacaag
tgggtcactgttgcttcagccattcagaagaacaccatgagagtcaccagactccatgat
ggaacagagtacctattcagagtatgtgctgaaaacaaatatggtgttggagacttcctg
agatctgatccagtggtggctaaacatccattcaatgcgccagaggctccagagccacca
caggtcttggctattcgccatgagtctgctattgtgtcgtggtcagatccaaaggataca
ggaggctctcctattacaggataccatgtggaattcaaagataggaacagtttattatgg
aagagagccagcaagacacctctgagagtgaaggagtgtagagtgactggtttagttgag
ggccttgagtatgaattcagagttatggctataaacgtggctggaataggaaaaccaagc
aaaccaactgaagcatttgttgcccttgatccaattgatcctcctggcaaacctgatgta
atcaacattacaaggaacagcgtaacactcatttggactgcgcctaaatacgatggaggt
cacagactgaccggctatatcattgaaaaactagagcatccaggaaaggtctggatgaag
gccaaccatgtcaatatccagagttgtgctttcacagtaacagatttgcaagaaggctgc
atgtatgattttagaattagggcaaagaatgcagctggtgccatcagtgctccctcagag
caaactgacacccttgtctgcagagacgaatatgaaccaccaactattacaattgaccct
gaaatgaaggatggtgtcactgtcagggctggagaaacaattgtgatttctgcatcaagt
atccttggcaaacctccacctatatctgtatggtctaaggaaggaagagaattcaagcca
tcagatgttgtccagattacaagcactcccacatcttcaactctgtcaattaaatatgcc
agcagaaagaacactggggagtatataattactgccagcaacccatttggtattaaggaa
gaaagagtaaaagtaaaagtcctagatgtgcctggtccacctggtcctattgaagtcagc
agtgtctctgcagaaaaatgcacactgacatggttaccaccagaagaggatggaggctgt
gctatcaaatcatacatccttgaaaagagagaaactagccgtctactttggacaaagctt
gctgaaaatgtaatggattgccgttatgtggcctgcaagttgattaaaggcaatgaatat
atcttccgtgtttcagcggtcaatcagtatggtacaggtgatgctatccagtctggtcca
gtcaaaatggttgacagctttggaccccctgggccaccatcaaaaccagaaattgataat
gtcagcagaaccgctgtaactatttcctggaagagaccagtggtggatggaggaagtgat
attagagggtatagtgttgagagaaaggagaggagaggtatgagatgggttagagcttca
aagaagaccatttccgatctacgttacaaagtatcaggccttacggaaggagttgagtat
gagttccgtgtaactgctgagaacaaagctggttttggagtacccagtgagccatcccaa
ccagtgctgacaaaagacattgcatatccacctggacctccatccaacccaagaataact
gataccaccaaaacaacagcaacatttaactggggaagaccgttttatgatggtggcctt
gatgtgacaggatatattgttgagcacaaaaaggaaggagaagatgattggattcaggac
acaacttctcccttgagaatcactgagtttgttgttccaaacctacaagcagggggcaaa
tataatttcagagtcagtgccattaattcagaaggatgtggggaacctgctgaagttgaa
aaaattgtggaacttgttgaccgtgaagagattcctgactttgaacttgatgcagaactg
agaagaacacttattgtccgatcaggtgcctccatccgcatatttgtaccaattaagggc
cgtccaactcctgaagttacatggatgaaagataatgttgctctcaaaggtagagctcac
attgacagtactgagtcatacactctagtggttgtccctgagtgtacaagatatgatgct
ggaaaatacattttgactttagaaaatgttgctggaaagaagacaggatttgtcaatgtc
cgagtcgtggacacacctgggcctccagtcaatttgaaaccaagggaaatcaccaaaaac
agcattacacttcagtgggaaattccaattattgatggtggctcaaagatcaaaaattac
ataattgagaagcgtgatgcaactagaaaggccttcacaacaatcactacaaattggcag
aaatgttcataccaggttaaagatttggaagagggagctgaatattacttcagagtttca
gctgaaaacgaacaaggtattggtgaggcagcagagacaccagaacctatcagagcttct
caggctccatcttcaccagacaatttagcagttacagatgtgacaaaggatacagcaact
cttgcatggacaaaaccaatttatgatggtggtagcagaatcactggctatgtgattgag
gctcagaagaagggttctgatcagtggctacatgtcaccacaataaaggctttggactat
actgtaacagatttaacagaaaatgcagaatatgtattccgtatctttgctgtgaacagc
tcaggtagaagcgaacctcgtgaaagccggccagttgaaatcaaggagcagactaccgca
ccaggatttgacctcagatctgtctatcagaagttggtagtagccaaagcaggtgataat
gtgaaggttgagatccctgtttttggtcgtccaagaccatctgttgtctggaagaaagaa
gatcaggaacttaaacagacacaaagaatcaacattgacaacacaacgacctcgacaatt
cttaacatacgagaaatcaagagaaaagatggaggacagtattcaatgacagggaagaat
atactgggaacagtgacagaaaccattactgtacaagtacatgatatcccaggacctcca
actggaccgattaaagtggatgaagtgtcctgtgactatgtagttatatcatgggatgca
ccagagaatgatggaggagttcctatcaataattatattgttgagatgagagagacaact
ggcacatcttgggttgagttagcagctactgtcattcgcacaacattcaaagctgctcgt
cttacaacaggaattgaatatcagttccgtgtaaaagctcagaacagatatggtgttggt
ccctacataacatctgaacctgttgttgctgcttatccatttgaggtacctggccagcca
ggtattccacaagttgttgccttcacaaaagattctattacaattagctggaatgaacct
tccacggacggaggaagcccgattttgggatatcatattgagaggaaagagaaaaacagc
atcctgtggcagcggatcagcaaagcccttgtagttgggaacatttttaagtcatctggt
ctgatggatgcaattgcatacgaattccgtgttattgctgaaaacatggctggtcttagt
aagccaagcaaggcttctgagatgacatttgcacttgatccagtggaccctcccagtcaa
ccagtggcacttaatataactagacatgagattacccttcagtggatgaagccacagagt
gatggtggtttcccaatcactgggtacactgtggaaaagagagagctgccaaatggtcgc
tggctcaaagcaaactttagcaatatccttgagacaagcttcactgtaagtggactgaca
gaaaattcttcatatgaattccgtatctttgcaagaaattcagctggatctgtcagcaag
ccctcgaaaccctcagaagtcataatctgcagagatgatattgaggagccaaagcttgat
gttgatgcaagctttagccatattgtggtagttaaggcaggtgatgtcttcaaactagat
gcaaatgttactggcagaccaatcccatcttttgtatggacaaaagatgggaaagaactt
gaagacactgcaaaactagagattaaaacagcagatttctatacctgtttaatcaacaaa
gattcatcacgaagggatggtggtgcattcactctaactgcaagcaaccctggaggattt
gccaagtttgttttcaatgttaaggtccttgataggcctgggcctcctgaaggacccctt
catgttacagacatgacaacagagaaatgtattctgtcttggctaccaccacttgaagat
ggaggagcaaagattgaatattatataattcagagacgtgaaacaagcagacttgcatgg
acaaatgtagccacagatttacaagtcaaccgttataaagttaccaaattgctaaaagga
aatgaatatgtcttcagagttatggctgtgaataaatatggagttggtgagccccttgag
tcagaacctgcagttgccactaacccatatgtaccctctgatccaccacaagctcccgaa
gtaacaacaattacaaaggactctatggtggtttgctggggacatcctgaaaacaatgga
ggaagtgccataactacttacataattgaaagaagggataaaactggcctccgatgggtc
aaatgcaataagaggtcagtaactgatttgcgctttaaagtgtctggacttacaccaggg
catgaatatgaattcaggatccttgctgaaaatgctgctggtttaagtgctccaagccct
tcaagtccattttataaggcatgtgacacaatattccagcctggacctccagggaatcca
agaattttggatacaacaaagtcatccattactgttgcttggaacaaaccagtttatgat
ggtggttcagacattacaggatatattgtagaaacctgcctaccagaagaagatgaatgg
acagttgtcactccaaaggaaggtcttgtaggaacatcatttaccataattaatttaaga
gaaaaccaagaatataagatcaacatttctgccctgaactgtgagggagttggagaacct
gcatcagtacctggttcaccaaaagcagaggacagatatattccacctgaaattgagctt
gattcagatcttcgaaaagtggtgaacattagagcttgcagcacactgagactgtttgta
ccaattaaaggaagacctgcaccagaagctaaatggtcaagggagaatggtgaacccctt
gataaagcatctattgagaccacaacatcattcacatcacttgttattgagaacgttaac
aggtttgacagtggaaagtatttactaacagtggaaaacagctctgggagtaaaacagca
tttgtgaatgtcagggtgcttgacactccaggggcaccacaaaatctcacaattaaggaa
atcacaaaagattctgtctcactgatctgggatcctccaattattgatggtggatcaaga
gtcaggcattaccttgtagaaaaacgtgaatccacaagaaaggcatattccattgtaaat
gcttcctgccccaaaacaagctggagaattggtgatctgcaggaaggaagtttatatttc
ttcagaatcttggctgaaaatgaatatggcgttggcctcccagtggaaactgctgaacca
gtcaagatttctgaaaagcctttacctcctggcaaggtcactcttaaagaggtaactggc
agcagtgtaactctgtcatgggagaagccagatcatgatggaggaagcaggatcacagga
tatgttgtggaaatgcaaggaaagggcagtgacaaatggactcaggtaatgactgtaaag
gtaacagaggcggttattgctggtctgactcgaggtgaagagtactcattccgtatatca
gcaacaaatgaaaaagggacaagtgatcctcgtctactcagtgtgcccgttgtggcaaag
gatcttgtcatcacacctgcattcaagcttttatttaatacattcagtgtgctggcaggt
gatgacctgaagatagatgtaccttatgttgctcagcccaaagcagcagttacctggttt
aaagatggtactgttctcaaagagacaacacgggtaaattctgaagttactgacagtcat
ctataccttgtaatcaaggaagcaacacgtgatgatgtgggtaaatatactatcaagatt
ataaactcagctggagaagctaccgctgacatcactgttgttgtacttgataaacctggt
cctcctactggacctatcaaaatagatgaggtaactgcagacagtgtgacattgtcatgg
cagccaccagagtatgaaggtggttgtacaattaataattatattgtggaaaagagggac
acatccaccacaaactggcagattgtgtcagctacagttgctagaacaaccaccaaagct
gcaagactgaaaactggctgtgagtatcagttcaggattgcagctgaaaacagatatggt
aagagctcttttctactgtctgagcctgtaattgcacagtatccatttgaggtgccaagt
gcaccagggactcccactgttcagtctgctaccaaagaaactatggtcattgtttggaac
aggcctagcagtgatggtggaagcaagattattggctatcatcttgagagtaaagaaaga
aatagcctcctgtgggtgaaacaaaataaaaccatcattccagacacaagattcaaggtt
agtgatctcgaagaaggcattgaatatgagttcagggtttatgctgagaatattgttgga
ctgagcaaagccagcagagtgtcagaaatacaggtagcaagagatccctgtgaccctcca
ggcaaaccagaagcagtaattgtcactagaagctctgtaacattacgatggacagcacca
gaatttgatggtggtagccgaataactggctatgtagttgagaagaaagaattgcctaat
ggtcgctggatgaaggctagtttcactaatatcatagaaactgaatttgttgtcagtggc
ttggtggaagaacaacagtatgaattccgagtcattgcaaaaaatgcagctggtgtatat
agtgtaccatctgacagtactggtgcaataactgcaaaggatgaagtagagccacctatg
attgacttggatgctaaatattctcaaaccattattgttaatgccggagaatcgtttaag
attgatgctggaatatctggcaagcctataccatcagtccattggataaaaaatggtgag
gaacttgctaatacagctagacttgagattaaaaataccgacttcacagcctctctaagt
gtaaaagaagctattcgtgttgatggaggccagtacacactgctactgaaaaatgttggt
ggtgagaaatccataaacatcaatatcaaagttctagacaggcctgggccaccggatggg
cctatttctatatatggggttacaagtgagaaatgctgcatagcatggaaaacaccttta
catgatggaggtgctgagatatctcattatattgttgaaagaagggagaccagccgatta
gtttggactgttgtggaatctaaggtgcaaacccttaatctgaagattaccaagctcctt
cctggaaatgagtatattttcagagtgatccctgtcaacaaatatggaattggtgagcct
ctggaatctgatccagtcattgccacaaatccatttgtcacacccgatccaccaactggg
gtggagatatccaatataacaaaggactccatggttgttacttgggaaagacccattaat
gatggaggtaatgcaattacaggatacgtaattgaaaagagggacaaagaaggtgtcaga
tggacaagatgcaataagcgtttagttagtgaactgcgctttagagtgacgggtcttctt
gaaaaccgcagttatgaattccgtgtctctgctgagaatgcagctggaattggtaaaccc
agtgcccctactgtatacttcaaggctttggatccagtcttcaggccaggtccaccaaac
aaccctagggttattgatatctcaaggtcatctgttgtactacactggagcaaacctatt
tatgatggtggatgtgagattcaaggttatattgttgaattctgcgaaggcacatctgat
gagtggacaatgtgcacgcctcccacaggaatcacagaaacaagatttgaagttaaaaaa
ctgctggaaaaacatgaatacaaattcagaatttgtgcgataaataaggctggagttgga
gaacatgcagatatcaaagaatccattcttgtggaggacaaactagaggcaccagatatt
gatcttgatgctgacctaagaaagatgatcactgttatagctggaggagccctgagattg
tttgttccaatcagaggacgaccagctccagaggtcaaatggggaaaagctgaaggtgaa
attaatgagacagcacagattgacatcacaagcagttatacttcccttgtaattgaaaac
ataaacagatttgacagtggaaaatacactttgtctttggaaaatgcaagtggtacaaaa
tctgcatttattagtgtcagagtacttgacacccctgatgcacctgcaaacttccatgtg
aaggaaataacaaagaattcagttaccctcacatgggagccacctttgctggatggtgga
gctaaaataaaaaattatattgttgaaaagcgtgagagtacaaggaaggtatactctact
gttgcttcctgcaacaagatgtcatacaagatcgagcagctccaagaaggcagcaactac
tactttagagttcttgctgaaaatgaatatggaattggattacctgctgaaacactagaa
ccactaaaaatctcagaagtgccacaacctcctggaaaaatctctgtggtggatgttaca
cgcaagagcatctcactgtcctgggaaaaaccagaacatgatgggggtagtagaatcact
cactatgaagttgagatgcaagcaaaagacagtgaaaagtggtctgtgtgtgcacaagtt
aaatcacttgacaccattattaccaatttagtccaaggtgcagagtacaattttagggtg
attgcagttaatgacaaaggaaagagtgatcccagacatctagcacacactgttcttgca
aaagaccttgtaattgagccatctgtaaggacaaaacttagcacatacagtgtacaagtt
ggccatgacttgaaaattgaagcacgtatcactggtcatccaaagccaatcattacatgg
actaaagatggtacagagctgaaacagaccacaagagttaatgttgcagacactgcccac
catacaacattattgattaaagacgcaacaagagatgatggtggtatgtacaacattaca
gtagctaatgtactaggacaaaaggaggccactgttgaaatcattatacttgacaaacct
ggtccaccaacagggccagtaaggatagatgaaataagtgcagaaagtattacactgtca
tgggatcctccaacctacacaggaggatgccaaatttcgaattacattgtgcaaaagaga
gatactaccacaactaactgggcagttgtttcagctacagtagcaagaactacactcaaa
gttggaaatttgaaaactggagctgagtaccagttcagaatctttgcagaaaatagatat
gggaaaagctatgctatagactcagagccagttgttgctcagtatcctttcaaagagcca
gggcctcctggaacaccatatgtgtctgcttttacaaaagaatctatggtagttgaatgg
cacaaaccagtttcagatggcggcagtgctattcttggatatcatcttgaaagaaaagaa
aagaacagtattctctggacaaaaataaataaaatgcttattcaagacacccgatttaaa
acatctcctttggaggaaggcatagaatatgagtttagagtttctgctgaaaatattgtt
ggaattggtaaatgcagcaaagtttctgaaggttgcgtggcccgtgatccatgtgatcct
cctggcacacccgtgccagtaattgtgacaagacactcggtgatgctgagatggacacca
ccagaatatgatggaggcagtctggtcactggatatattgtggagaaacgggacctccca
gatggccgttggatgaaagcaagctttacaaacatccttgaaactgaatttacagtcaca
ggtctgacagaagactcaaaatatgatttcagggtcattgctagaaatggtgctggatca
gtcagcaaaccttctgcatgcacagggccaatcacagctaaagatgaggttgagccacca
acctatgagattgactcacaatacagccaagtaatgattgtaaatgctggagatacattt
gtactgcaagcatctgtattggggaagccagttccaacaatgcagtggttcaaaggtgat
gtggaagttgaaaattctgcaagagctgagaccaagaacacagacttcaaagcagttctt
gttatcaaagatgctattagagttgatggaggacagtacactttgcagcttaccaatgtt
gggggaactaaatctgtgccctttaatgtaagagtgcttgatagacctgggccaccagca
ggacctctgacagtttcaaatgtaacaagtgaaaagtgctctttgtcatggcttcctcct
gtacatgatggtggtagcagtatttctcattacatcattgaaaaaagggaaaccagccgt
cttacttggactgtagtgtctagtgactgtggagcaactatgttcaaggtcactaagctt
ctaaaaggaaatgaatacatcttccgtgtcatggctgttaacaaatatggtgttggtgaa
cctttagagtctgtaccagtaataatgagaaatccatttgttcctcctggaccacctaga
gaactagaaataacaaatatctcaagagattctatgactgtgtgctggactcgcccagag
tctgatggtggaagtgagattgttgggtacattgttgaaaagagagacagagctggagtc
agatggacaaaatgtaacaaacgtagaattacagaccttcgcttcagagttacaggtctt
acagaggaccatgaatacgaattcaggttatctgcagaaaacgctgcaggagttggtcaa
ccgagtccagcaactctgtattacaaagcatgtgacccaacatttaaacctgctccacca
actaatgcacatattactgacaccacaaaggactcagtgactattgaatggagtagacca
atctatgatggtggtttagacatccagggctatgttgtagagatctgcaaagctgatgaa
gaggaatggctaacatgtactccacctactgggttgaatgatactaaattcacaattacc
aaactcatagaacatcaagaatacaaggttcgaatatgtgctcttaataaactaggtgtt
ggtgagccagtcaccattcctggtacagtaaagcctgttgataaaatggagcctcctgaa
attgaacttgattctgagttaagaaagggcattgttgtccgtgctggaggaagcatgaga
attagcattcccttcaaaggccgtcccactccagagataaactggactaaggatcatggt
gatctaccaagtaaagcacaaattgaaaagggtctagattatacccagctttcagttgac
atatgtgataggaatgatgcaggaaaatatattctgactctagagaacagcagcggtacc
aagtcagcatttgtttcagtgaaagtactggatacaccaggtgctcctctaaacttaact
gttaaagatatcacaagaaattatgtaactcttgtttgggagcctccacttattgatggt
ggggcgaagataaagaattatattgtggacaaacgtgaatcaactagacctgccttctct
aatattactacaaaatgcaccaagactagcttacgtgttggtgatctcgatgaaggtggc
atttattacttcagagtcatggctgagaatgagtttggagtaggtctgcctgtagaaaca
gaggaatctgtgaagacagcagatcctcctctatctgtgggtaaggtcacattgactgat
gtgactaaaacttctgcatcactttcatgggagaaaccagaccatgacggtggtagtagg
attctaggatattatattgaaatgcagccaaaaggatcagaaggctgggtagtagcaact
actaccaaaacctgtgagggaacagtcacaggacttagcgctggccgagagtacctcttc
cgagtgtcggcctacaatgataaaggaaagagtgatccaaggccactggcagctccagtc
atagctaatgatataacaattgaaccagccctcaaactgactttcaacacatacagtgtg
aaatatggtggagagctgaaagtagaaattccagtaaaaggtcgtccaacaccaaaggtc
acatggactaaagatggccactcattaaaagagacaactagactaaatgtctcaagcacg
gcaacatcaacaattcttagcatcaaagatgccaatagagaggattctggcaaatataca
gtaacagctataaacaatgtaggatcagtctcagaggaaattggcgtaatcatcttagac
aagcctggtccacctgttggcccagttaaaattgatgaagtaagtgccaactatgtaata
atttcatgggaaccacctgtgtacactggtggttgtcaaataaacaattacattgtggag
aaacgagacacaactaccacagcctggcagattgtatcagcaaccattgcacgtacaaca
atcaaaatttctaagctgaaaactggctcagaatatcagtttagagtgtttgctgaaaac
agatatggaaaaagttcacctttagactcagtacctgttgtcgttagctatcctttcagt
gaacctgcagcacctggtacaccatttgtgtcctcagtgacaaaagatcacatgacagtt
gaatggaagccacctagtaataatggaggtagccctgttcttgggtatcacattgagcgc
aaagagaagaacagtattctctggacaaaacttaacaagcttcttgtaactgatactcaa
ttcaaaacaaatggtctcgaggagggcattgagtatgaatatagagtatttgctgaaaat
attgcaggaataagtccatctagcaaagtttcagaaactgttgtagcacgtgatccatgt
gatccacctggaactccggaggctattgttatcactagaaaccttgtcacacttcaatgg
acaaggccccaatacgatggaggcagtgtggtcacgggttatattgttgagaggaaaaag
ctacctgatggtcgttggatgaaggctagctttacaaatataattgacactcagtttaca
gttacagagttgacagaaggagaccgttatgaattcagagtaattgcaagaaatgcagct
ggtattttaagtgagccttctgaaagcactggaataattactgcacaggatgagattgaa
gcaccttcagtttccatggactcaaaattcaaggatatcattatcgtgaatgctggtgag
acatttgctattgatgctgatattgcaggcaaaccactcccagatataaggtggctaaag
gatggaaaagaaattgacagtgctactccaagaatggaaattaaatccactattacacat
actgttttaaccgttaaagattgcataagggtagatggtggacattttgtcctaagcctc
agcaatgtgggtggaacaaaactggtccctgtaaatgtcaaggttctggatagacctggt
ccgccggatgggcctctgaaggtaactggtgtcagagcagagaaatgttatctacactgg
agccatccaacacatgatggtggagctagtgtttcacattacattattgaaaagagggaa
acaagcagactgtcttggactatggtagaacccaaaattcaagctatcagttataaagtc
accaaactcttgccaggtaatgagtatatctttagagtcatggcagtaaacaagtatggt
attggcgaaccacttgaatctgaaccagttgttgcaagaaatcctttcaagactccaggc
ccaccttcaactccagaagcaagtgcaatcactagagactcaatggtcctcacatgggac
cgtccggaggatgatggtggttcaccaatcgagggttatatcctggagaagcgtgacaaa
gaaggtatccgatggacaaagtgcaacaggaaaagacttactgacctccgtttcagagtc
actggattaacagatggacactcttatgaattcagagtgtctgccgaaaatactgcaggt
gttggcacaccaagtgaaccatctgaatattacaaagcctgtgatgcaacctatcctcct
ggcccgccaaacaatcccaaagtgacagaccattcaagtacaactgtttcccttgcatgg
agtaggcctatttatgatggtggtgcaccaatctctggatatattgttgagatgaaagaa
gcctgtgatgatgaatggacactatgtacaccaaacactggtgtacaaacaactcacttt
acagtgaaaaacctgaaggaaaatgcagaatacaagttccgtatttgtgccattaatatt
gaaggtgctggagatcatgttgatgttccaggctctgtaattgctgctgagaaacttgaa
gccccagaagtagagttagaagctgatctgaggaaaattgtgactgttcgtgcaagtgca
acactacgcttgtttgttaccatcaggggaaggcctgagcctgaagttaaatggacaaag
gctgagggacccctaacagagcgtgcccaagttgaagtcacaagctcttacaccatgctt
gttattgacaacgttgacagatttgacactggcaagtatattttaactcttgaaaacaac
agtggcaccaaatctgcgttcgtaaatgtcagagtcctggactccccaagtgctcctgtg
aactttgtcgttaaagatatcaaaagagactcagtccagctgcagtgggaccctccacat
attgatggcggtgccaagattactcattacattgtggagaaacgtgaatctaaaagaatg
gcatttacatctgtgacaaataactgtgtcaggaattcattgagggttgatgatctccaa
gagggaggtgtttattacttccgtgtacttgcagtgaatgaacttggtgttggcttgcca
gcaaccaccacagagccggtcaaagtgtcccaagcaccgctaccaccaggaaaggttaca
cttgttgatgtaactcggcacagtgtgagtctttcttgggaaaagccagaccatgatggt
ggtagcaagataacaggttacatagtagagatgttgactaaaggatcagataaatggact
gtatgcacaacagtaaaaatgcctgaagctacagttgaaggacttacaacaggggaggaa
tattcattcagaatttctgccatgaacgacaaaggaaagagtgatcccaaaccactggga
gcacctgtggttgccatggatatcactgttgaacctgttattgacttgctatttcacaca
tacagcattagatctggagaagatctcaaaattgatgttccatttagaggtagacctcac
ccagaagtgacatggaagaaggatggccacaccctgaagcaaacgaccagagtaaatgtt
cttacatccaaaatgtcttcaaagattgttatcaaagatgcaataagggaagatgctgga
aaatacgaaatcacactgactaattcagttggtgtaaaatcagctgaaataacagttatc
attcttgacaaaccaggtccaccaacagcagtcagagtcgatgacgtaagtgcagattac
atttcattatcatgggatcctccagtttatgatggtgggtgtcaaatcaataattatgtt
gttgagaagagagatacaaccactacaacatggcaaattgtttcagctacagtggcaaga
acatcaattaaagtgtcccatttgacgcagggaactgaatatcaattccgtgttgctgct
gaaaatcgttatggcaagagccatgctgttgactctgcaccgattgttgcacaatactcc
ttcacaccacctggccctccaaatgaccttcaagttgctcatgctacaaagtcaggcatg
ttggttacatggaaaaaaccaaccagtgatggtggaagtcctgtcattggatatcacttg
gaatgcaagggccaaagcagcattctctggactaagatcactaggggtcttgtttctgat
acacagtttaaagtaactggtcttgaagagggacttctctatcagtacagagtatatgca
gagaatattgcaggaattggaccttgctcaaaagcctgtgagcctgttgctgcaagagat
ccatgtgatcctccaggtcagccagttgttactaatataacaagaacttctgtttctctc
tcctggacaaaacctgaaaatgatggtggtgccaaggtgactggttatattgtagagcga
agagaactaccagatggtcgctggttgaaatgtaatttcaccaatctccaagaaacattc
ttcgatgtgactggcctgattgaagatcaaagatatgatttccatgtaattgcaaagaat
gcagctggtttacttagtcagccatcagagtgtacaggccctgttacagtgaaagatgat
gttgatccaccacgcattacaattgaggaaaaactcagacaactagttgtagtcaaagca
ggagatatactaagaattgatgctgaaatttctggccgcccagctcctgtgatttcgtgg
gcaaaggatggaaaagaaatcgattctaaagcaagagttgaaatttcttcaacattcaca
accacaacactaattgttagagacaccatcagaagagactctggacagtacgttctcaca
ttacagaatgttgctggtaccagatctttagcagtgaactgtaaagtccttgataggcct
ggcccatcatctggaccattggaagtaactggtttgacagcagaaaaatgcacattaact
tggggaccaccccaagaaaacggcggtgctgaaattcaacactacattgttgagaagcgt
gaaacaagccgtcttgcctggacattagtctatgcagacatgaaggccacaacatgcaaa
gttacaaaactgcttaagggcaatgaatacattttcagagttcggggagtaaataaatat
ggaacaggagaagctctggagagtgatcccattaaggccctagatccatttacagtgcct
gctgcaccaacaaatgttgaagtcacaagtgttacaagcgaagctatgacaatctgctgg
gaaaggcctgtttctgatggcggcagtagtattagtggctatgtaatagaaaaacgtgaa
aaatcaggtcttcgttgggttcgtgtcaacaaaaagcctgtttatgacttgagggtcaaa
gcctccaatctccgtgaaggatgtgaatatgaataccgtgtatatgcagagaataccgca
gggttgagtgaaccaagccttccctgcccattgacaaaggcagaggatccattattcttg
ccatctccaccagtgaaaccaaagataattgattctaccaagtccacaataacactctct
tggaacaagccattgtttgatggtggttctccagtcacaggatactcagttgaatatagg
aaaaccaatgatgaggactggattgttggggtgcagcacactaataacactgagtttaca
gttgtagggctgacatcaggagcagaatatgtctttgtggttaggtcaattaataaagtt
ggtccaagtgagccaagccctgagactgatccacaggtagcaaaggacagagaagatgaa
cccgttttcctcatcagtaatgaattgcgaaaaacactgattatcaaagatggcagctcg
ttcaccttaagagttcctttcaaggggaaacctgtgccaaatgtaatgtggaacaagcct
gatgttgatcttagagttcgggcaacaattgataccacagatacttgcacatctgtcaca
attgagcaagctacaagaaatgactcaggcaagtacactgtgactctacaaaatgttgct
ggaacagccacactaacattgaatgtaaaagtgctcgattcacctggaccacctgccagt
ctttcagttaaggaagtgaccaaaaactctgcaacaataacatgggacacaccagaaaat
gaaggtggtgctcctgtcaagaactaccttgttgatctgcgtgaggcaagcaaaaaagga
tggacaagagtcacagaaagttgtcccagacttacctacaaagtaactgaccttcaagag
ggaggcgtttattatttcagagtcactggtgaaaatgaatatggaattggcgtaccactt
gaaactaaagagggaactaagattacagaaaaaccaagtccaccagcaaagcttggagta
actgatgttacaaaagatactgtctcgttagcttggagtaaacctgagcatgatggaggt
agtagaattaccaattaccaggtggatgcactggagaaaggacaacagaactggataaaa
tgtggtgtcaccaaatcgactcactttgttgtctatgggttaagagagaatggagaatac
ttcttcagagttcgtgctgaaaatcttgctggatttagtgatcctaaagacatggttctt
tctgttcttgttaaagatcaactagaggcacctgaaattaacatgaagaactttcagcat
aatacagtctatgtaaaggcaggctcaaatcttaaagtagagatccctcttactggtaaa
cctttaccaaaagtatcgctctcaaaggatgatcaggtcctgaaatcaaccatgaggttc
aattctgaagtaacacctgactgccttctcatcaccctccgtgacagtgttgctcatgat
gcaggcagatatgacattacagcctcaaactcaagtggaaccaccaagtcctttattaat
attgttgtcctggacagaccaagtccacctgttggtccagttgagatgtgtgatatcaca
gaggacagtgtaagtctgaaatggctccctcctgcatatgatggtggcagcccaatcacc
aactatattgttctaaaacgtgaaacaacaacagcaaactgggttgaagtttcatctgca
gttgcaagatgcacaattaagattatgaaactaactactggagttgagtatcagttcaga
attagggctgaaaatcgctttggtatcagtgatcacatcgattctccaactgtcacagtc
aatctgccatatacaattcctgaggcacctacaacaccatgggtatctgctgtcactaga
gaaagtattactgtcaactggaaagaaccttcttctgatggaggaagtcatatatttgga
taccaccttcagatgaaagacaaaaacagtattttgtggaagaaagtcaacaaaactgtt
atccgtgccacacatttcaaagttacaaacatcaatccaggccttatctatgagttcaag
gttgcagcagaaaatgctgctggcattggtcctgtcagcaaaatttcagatgctgtactg
gcaattgatgcttgtgaaccaccaactgatgtccgtgtcactgatatcacaaagagttca
ataagccttacatggagtaaaccttcctatgatggtggaagcaaagtgacagggtacata
attgagaagaaagatggtccaaaaggcaaatgggtcaaaactaatttatcaaaggtttct
gacaccaggttcactgtatcaggcctcattcaagatgaatcttatgaatttagagtctta
gccaagaatgctgttggctctgtcagtaacccatctgctactgttgggccagttacatgt
gtggatacttttggtgctcctgaaattgaacttcctcaggaatacctggatgttgtaaaa
tacagagcaggagcaactgtccagcttagaattggcattattgctaaacctcagccaaca
attgaatggtacaaagatggaaaagagctggaatctggagctcagctcatgatatcaaac
accactgattctgcatgcatctcaataaaggatgctacacgcataaacactggaacatac
gaactcaagatcaagaactctttgggctcagcatatgctgctatcagagtacttattcaa
gacaaacctgggccccctgcgggacagattcagttcaagaagatcacagcagatagtata
accatcatgtgggatcctccagctgatgagggtggtgcaatggttacccattacattgtg
gagaaacgtgagagtagcagaattatgtggtccataatatctgagaaactagaagactgc
attgtctctgtttcaaggctgatcaaaggaaatgagtacatcttccgtgttcgtggggtg
aacaaatatggagttggagatcctttagaatctgagcctgtcattgcacagaatttattt
gtacctcccagccaaccttccaaacctcaggtcaccatgattactaaatcaacgatgaca
gtcatatgggaaagaccaagtctagatggtggcagtgatattgatggatattatctggag
aagcgagaaaagaagagcctacagtggttcaaggtcatcaaagatccaatccgtgatact
aggcaaaaagtcagcaatctcacagagggaaatgagtatcagtatcgtgtttgtgcagtt
aataaagctggtgcaggtcaatactcggatgcatccatcttctataaagcatatgatccc
attgatccaccaactgagccgacaaaacttaaagttgttgattcaaccaagacttcaatt
acacttggatgggtgaagcctgtgtatgatggtggcagtgaaatcacaagctacatagtt
gagcagatgacagctgatgagaaggagtgggttactattagctccaagggtgaagtaaga
accacagagtatgtggtgtcccatttaaaacctggattgtactattacttccgcatctct
gctgttaactgtgctggagttggccgcccaattgaaatgattcagccagtacaggctaag
gatattctggaggaggctgatgttgatcttgacatttcaatgtcaactcagtatacagca
aaggctggaagagatgtggaaatcatgattcctctaaaaggcagacctgcaccaaatgtc
acatggcgaagaggagataggaatattggtggagatgcaaaatacacaattaataacaca
gagtattcaacaacacttatcattccaaaggtcactcgggacgattcaggcaaatatctc
cttgagattgaaaatggagttggtgaaccaaagaatattactatctctgtgaaggtatta
gactcaccatctgcttgtagtaagttggtagtgaaaaatgttacccgtggtaaactcact
ctgagctgggatcctccatttattgatggtggatctccaattacaaattacatcattgag
aagaaggatgctaaactcaaggcttactccatagttacaacagaatgtgccaacacatcg
tacaaggttgaaggcctgtcagaagagattgcctatttcttccgtgtgtctgctgaaaat
gaaaatggtattggtgatacttgtgaaaccacagaacctgttagagcagctgagactcct
ggtcctgtaaagaaccttgtcatggttgactcaactaatacatctgtaactttggcatgg
acaaagcctgatcatgatggtggcagccatatttctgagtacatcattgaaaagaaggca
gatgatgctgtgacatggagccttggtggtacatgcagatgttgcaagtatgaggtaaca
aaccttaaagaactctcagaggttttcttcagagtgtatgccaagaatgagaagggttgc
agtgacttctctcaaattggacccattactgtgaaggaatccttaattccacctgaagcg
aaccttattgactatcctaatggtgaattaagcgtcagaattggacaaaatgtgaacatc
gaattgccatacaagggtaaacccaaacctgcaattcagtggatgaaagatgatgttcca
ctgaaggaaagtgaacaggttcgtttcaggcaaacagagaataaagctagtctaactgtg
agaaatgcaagaaaggagaatgcaggaaaatacactctggtccttgacaatagacttgtg
aagaacttctttgacatcaaggtcatcactcttgggccaccctctgcaccagtgggccct
atccgatttgatgaaatcaaagcacagagcattattatctcatggaatgagccacaggaa
gatggtggtggagaaatcacctgttacagtgtggaaaaaagagagacttctcaagcagct
tggaaaattgtttgttcaagtgtggtcaggaccacattcaagatacccaatctcgttaag
ggcactgaataccaattcagggtgcgtgcagaaaacaaatatggagtaagtgagcctctc
aactcagtggatgttcttgctcaacaccagtataagccaccaggtccaccaggaaaacca
gttgtatttaatgtaacaagtgatggcatgactgtttcatgggatgcacccagctttgat
ggcggttcgcctattactggctaccatcttgagaagaaagatagaaacagcctcctgtgg
atgaaagtgaattccagtgtaatctctggaagagagtacagggtcattggtctcattgaa
ggtctggaatattcattcagagtgtatgctcagaataatgctggcatgagtccagttagt
gagcaaagcaagcacaaacttgctatttctcctgttgatccccctggcacacccaactgt
attgatgttacaagagattctgtcactcttcagtgggagccacctaaacgtgatggaggc
agtaggattgtggcatacagtgttgagaggcgccaaggaagagcacgctggctgagatgc
aattttactgatatcagtgaatgccagtttacagtgacaggacttgcttgtggtgaccgc
tttgaatttagagtaattgccagaaatgctgttggaacagtcagtccaccatcacagtca
tcgggctacatcatgaccaaggatgaaagtgttatccctgagattcagtttggtgctgaa
aagactctgacaatcaaggctggagaaaacatcaaactgagttgcactattagtgggcgt
cctgtgcctcaggttacatggtataaggatgggaaacagcttgacaaaatgcttgttgat
atcacaaccagtattgggtcaagttcactgttcattagagatgctgatcgtagtgaccgt
ggaatctacactgttgaagccaaaaacagctctggaacaacgaaggaggatgttcttgtc
agagtacaagatacacctggaccacctgagggcccacttcgcttcacaaatatctctgct
gagaaggcaactctttggtggagtcccccagaaaatgatggctgtgcagctatcactcat
tatgtgattgaaaagcgtgagacctcccgtattacttgggcacttgttacatctaagtgt
gaagcctgctctttcagtgccaccaagttgatcaagggcaatgagtatcagttccgtgtt
tctgctgtcaacagttttggtgttggcaaaccactcgaatcagatccaattgttgctaaa
atgcagtacactgtaccagatgctccaggaacacctgactgcactcatgtgacaggaaac
agtcttacactctgctggacaagaccaagacatgatggtggaaatgagataaagcactat
atccttgaaaggagagaaaagaaaagtttacaatgggtaaaagtttcagcaaaaagacca
atcacagagctcagacacagagtgacaaacttgactgaaggaaatgaatatgaattccgt
gttatggctgaaaacggggctggtgttggaccaccgagtggagtatcaagactatttaag
tgcagagaacctacaagtgcacctagcgcaccaacagtggtaaaagtccgtgattcaaca
aagacctctgtgagcctggaatggaccaaaccaatctttgatggtggtatggagatcata
ggttacattattgagatgtgcaaagcaagccttgaagaatggcacagagtcaatagccag
acttgtatccataccacatacacagttacagatttagaaccaggtgaagagtataaattc
cgtgtgtgtgctgttaatggtgctggaaagggagaggcatctgagattccaaatgcagtg
caagcagttgacagactgacatcaccagagattgacattgatgcagatttcaaacagaca
catattgtgaaaagtggaggaagagtttctcttaatatccctttccgtggaaaacctaca
cccctggcttcatgggcaaaagcagatggagaacttggtgtgatggtagatattaatact
acagacaccttcagcacattaacaattgaaaactgtaccagatatgatgctggcaaatac
acgctttctcttgagaacaacagtggtcgtaaatccattacattaacagtaaaagtgttg
gacacacctgggccaccaggtcctctctcattcaaggatgtgacaagaggagctttgact
ctcatgtgggatgctccgtccaatgatggaggtgctcgtattcatcattatattattgaa
aaacgtgaggcaagtcacctgagctggcaagaggtcagtcccaagtgtacacgccaaatt
ctcagagtgaccaatcttgcagttggtgtaccatacttcttcagggtcacagctgaaaat
cagtatggtgtaggtgagccttgtgaaatgtcagaacctattattgccactgaggagcct
gcaccacccaagaggctggacattattgatactacatcttcatcagccactttagtatgg
atgaagcctgagcatgatggtggaagccgcatcacaggatatattgttgagaccagaaag
aaaggttctgatcactgggttgttggtggtcaaacaaaatctttgaagatggtcctggaa
ggcttggttgagaacacagaatatgaattccgggtcaaagcacaaaatgatactggagtc
agttatccaagagatgcactcacctctgttatcatcaaagaacctcgcattgagccaact
gcagaccttagtggcatcagtaaacagcttattacctgtaagactggcagttcctttgcc
attgatattcccattagtggtagaccagctccaaaagtaacatggaagcttgaggagata
aaactaaaggaaacagaaagagtctctatcaagacttctaatgtgaaaaccaccctactg
gttaaggatgccaagagaggggacagtggaaaatactaccttactctagagaatgcggct
ggggcaaaaacattcagtattactgtaattgtcttcggcagaccaagcccacccactggc
ccaatagaaatctcaggaatcacagcagaatcctgtgtgttgacatgggctgagcctaca
gatgatggtggatcagatatagctaactatatagttgagaaacgcgaatctggtcaaact
tcatggcaggttgtaaattccagtgtgaaaagaccaacaattaaagtcacccatttgaca
aaatacatggagtacacattccgtgtctgcgcagagaacaagtttggtgttagcaaacca
gttgagtctcaagctattgtggcagaacatccatttgtaccaccaagcccacctacacgt
ccagatgtggtattagtatctgctaatgccatttccattaaatgggatgttccatatcat
gatggtggaagcaaggttactggatattggatcgagaagaaagagcgcaacaccatttta
tggacacgggaaaataaaatcccatgcattgagtgtcactataaggtctccaatcttatt
gaaggccttgaatatcagttccgtgtatatgccatgaacattgctggtctaagcaaagct
agtgaagcttcaagaccagtgctggctttgaatccagttgatccacctggcaaaccagaa
gtatatgacattacaagatcttcagtttctattaaatggtctgtaccatttaatgatggt
ggcagcaaacttgttggctatgtagttgaacgcaaggcatccactggagatgatgatgaa
actcgttggttgaagtgcaactacactactatcacagacaatttcttcactgtaacatca
cttgaagagggagcagtttatgaattccgtgtcattgcgaaaaattgtgcaggagtccac
agtatgccatcggaatcaacaggccctatcacatgcaaggacgaatacacaccaccaaag
gctgagttagacagcaaacttgtcggtgagacagtaactattagggctggatcagacctt
gttcttgatgctgcaataggtggtaaacctgaacccagagtatgctggtctaagggtgat
aaggagttggagcttggtgataagtactcgttgacatactccagcacaagagctatggca
atcatcaagtcctgtaacaggaatgatactggaaaatatatattgactgttaagaatgcc
agtggaaccaaaactgcagctgtcaatgttaaagttcttgatacccctggtcctccagat
ggtaaaattacaatcagcagagtcacagaagaaaaatgcacagtttcttggaagatacct
cttgaggatgggggagattttgtcactcactacattgttgacagacgtgagaccagtagg
ctcaactgggttgtcatggaaactgaatgcaagaccctttcttgtgtcagtacaaaacta
atcaagaacaatgaatatatattccgtgtcagagctgttaacaaatatggagctggtgtc
ccactggagtctgaaccaattattgcaagaaatgcatatactgttccaacacctcccgga
gcaccagaaattacagctgtcggaaagcaacatgtcattattgagtggctgaagccagag
aatgatggtggtagtgaaataaaaaattatcttgtggataaacgtgagaagagcagcgtg
agatggaccagagtaaacaagacattcaccatctatgacacaagactcaagataacaggt
ctattagagggaagcgaataccaattccgtgttgcagctgtcaattctgctggcacaagc
ttaccaagtgaagcctctgaatatgctctttgcagagatccaacgtataccccagctcct
ccatcagctcctcgcataatagatactaccaaacacagcatcactatgacatggaccaga
cctatgtatgatggtggttcagatgtcactggctatattgttgagattctagaagaggga
actgaacagtggtatagggccacccagaagatcctgactactaatgaatatactgcagct
ggtttaacaagcaacaagaagtacagattcagagtggctgcagtgaattcaatgggcact
ggagagttcagtgaaggcagtgtggagacttcacccacagaaagagttgaaattcctgat
attgaattacctgaagaactgaagaaaacagtttgtctgagagctggtagcactttacgt
ctaaatgcaaccatacttggaagaccactgccagttgttacctggagaaagtctggcata
gaccttcagtcaaggggatacattgacacaacagggagcactacaactttaatagtggag
aaggttcaccgttatgatgctggaaaatacacaatcgaggctgaaaatccatctggcaaa
aagacaattaccattcttgtcaagatatatgattcccctggtccctgtggtgcagtcaag
gtgaaggattacactaaagaatcagttgtcattacatgggatgtccctactattgacgga
ggggctcctatcaacaactacattattgaaaaacgtgaagcatcaatgaaatcttataaa
acagtgacattggaatgcaagaagacactgtacagaatcacagggttagaggaaggaaca
cgatacttcttcagagtactgcctgaaaacatatatggtattggagaaccttgtgaaacc
actgattctgtgctggtatgtgaaattccatctgttcctcaagatttgcaagtcattgac
attactaagtccactgtcattcttggatgggaaaaaccactttacgatggtggcagcagg
cttactggttatgttattgaagcctgtaagaaaggaactgaccgatggatgaatgttgct
aatgtgagagcatcagtatttcagcacaccatagattctctgaatgaaaatgaagagtac
ttctttagaatcaaagctgaaaacgacaggggggtcagtgagcccagagacctgttgaca
cctgtaactattcaagaacagagagttacaccaaagattgatctgactagcattcctcaa
aagattgtaagtgtgcatgctggaaagccaattgtgcttgacattcccatcactggaaga
cctgcaccaacttgcacatggttctttggtggcattaagatgaaagacaagcttgaccgt
attaaaattgagacaactgctaagtacactaaactaatggttcgtgaaactactcttgat
gataccggtgactatactcttgaagtaaagaatataacaggagtagctacagaaatcatc
aaagtcatcattcttgataaaccaggcattccagttgggcctatgagaattgatgaaatt
gatgccacatctgtaacatgcagctgggagccaccagagaaagatggaggtgccaatatc
agtggctatatagtggaacaacgagatgctcatcgccctggttggctgcctatttctgaa
tctgtcacaagacccacattcaaattcactagacttaatgagggaacagaatatgtgttc
cgtgtggctgcaacaaatcgttttggcattggtgcattccttcagtctgaagttgttgaa
tgcaagagtgccaagactgttcctggtgcaccaagcacacctgaaatatttgatgtgtcc
catgatggtatgacactcacttggaaaccaccagaagatgatggtggttcctcagtggcc
ggctacatcattgagcgtaaagaaagtagatctgacagatgggtgcgcatcaataagaat
ccagtgacaatgacaagatacagatcaactggattaattgaaggtctcgaatatgagtac
agagtgacagctatgaactctagaggcactggcaaaccgagtctgagctcaaaaccagtg
attgcaatggatcctatcgaacctccaggtatacctttgaacccaagagtcacagataca
accaggacatctgtgtcattggcatggtctcccccagaggaagagggaggtgccgtcatc
actggttacctgatagagatgcagaaagttgaccagattgaatggaccaaatgtaataca
actccaacaaagatttgcgaatacacactgacgcatatgcctcaaggggctgaatatagg
ttccgtgtgatggcatgtaatgctggtggacctggagaaccagctgagattccaggagta
gttaaagttacagaaatgcttgaatatcctgattatgagctggatacaaagtaccaggag
ggttatatcgtcagacaaggtggagttgtcagactctctgtgccaattaagggaaaacca
tatccaacctgtaagtggacaaaggaaggccgtgatatttcttacagagctatgattgcc
accagtgaagaacgcacagagctggtgatcaaggaagctcacagggatgacactggaacc
tatgatcttgtgttggagaacaaatgtggaaagaaagcagtttacatcaaagttaaagtt
attggacctccagatccccctgaaggccctctggaatttgatgatattcaagctcgttct
gtaagagtgagctggagaccaccctcagatgatggtggctctgacattcttggttacgtt
gtggagagacgtgaggtaccaaaggcagcatggtacactgtggactctcgagtggttgac
acttcactagtggtcaaaggactgaaagaaaatgttgagtaccacttcagagtttcagca
gagaaccagtttggaattagtagatctctcaaatcagatgaatcagttataccaaagaca
ccactctgtccaccggagcctcccagcttccctccagaaattatggaagtcacaaaaacc
actgttggcctgtcttggtcaagaccaaaggatgatggtggttctcgtgtcactggatac
tatattgaaagaagagagacgtcaactgaaaaatgggtgcgtcacaacaagactcacatc
acaaccacaatgtatactctcaccggccttatccctgatgccgagtatcagttccgtgtg
attgctcagaatgacattggtcaaagtgggcctggacctgtatctgaagcagttgtgtgc
aaggatccatttgataaaccaagccaaccaggtgatattgacatcatatcagttaccaag
gattgcatcactattcattggctgcgcccagaatctgatggtggcaaagaaattcttgga
tattggattgagtttagacaagcaggtgaaagtgcctggaaaaagtgcaacaaagagcgt
tcaaaagacaggcagtttaccatgggtggtctcatggaggcaacagaatatgaatttaga
gtgtttgctgaaaatgaaactggattgagcagaccccgtagaactgccatgggcatcaaa
accaaactgagtgttggagaagctccaagtctaaaggaagagatgaaagatactaccact
aaactgggggaatctggaacactgacttgccagattattggaagacctcttccagaaatc
aagtggtatagatatggaaaggaactgattcagagtcgtaaatacaaaatgagctctgat
ggcagaagtcattctctaacagttttaacagatgaacaagaagatgaaggtctgtacact
tgcagagccatcaatgaggctggtgagattgaaaccagtggcaagcttctcctgcaggct
gcacccctattccatcctggattccctttgaaggagaaatactatgcaggctgtggaaca
agcctacgtctccatgttgtctatattggacgtccaattccacaaatcatgtggttttat
ggcaagaaacctctaaatccatcagagaatgttattattgaaaacacagagaattatact
cacttggttgtcagaaatgttcagcgcaagacaaacgctggcaggtacaaggtgcaactg
agcaacaaatttggcacaattgatacagtgctatgtgttgaaatccaagataagcctctg
attcctgaagggccaattattgttgaagccctcttgaagaactctgtaatcataagttgg
aaaccacctaaggatgatggtggttcaatgatcacaaactatattgtagaaaaacgtgaa
gccaaggagggagagcaatggcatctagtgtcatcatctgtctcaggaaccacatgccgc
attccaaatctaattgagagtgctggatattacttccgtgtttctgcccagaatcagtat
ggtattagtgagtcattagagattcctgctgttgtcatcatcaagagtccatatgaaaaa
cctggaatcccacaacagccagtggttacttcattcacagagaattcctgtgttgtgaca
tggaaacccccatccagtgatggaggtgccaaaattaagaattactatctggagaagaga
gagaagaaacagaacaaatggattgctgttacaactgaggaaattcatgagacatgctat
actgttaaaggtcttattgaaggctttgagtatgagttccgtgtcaaatgtgagaacatt
ggtggagagagtgactggagtgagatttcagaacctgtcattccaaagtcagacacagct
cctcgtgctcccttctttaaagaagaactgagagatatgtgtgttaaatataaagccaat
gcaacctttgttactaaggtcattggctaccccaggccaatagtaaaatggtacaagaat
ggcaaagaaattttaccagatggtgagaaagtcaagatccaagaattcaaaggaggctac
caccaactttttatcagtaatgcagatgagaatgatgtggccgtttaccaaattagagcc
acaaatcaggaaggatcaatctctacaactgtaacacttgatgttgaagttcctgccaag
gttcacttgccattacatctacaaggtatgggagctgttcatgctgttcgtggtgaggta
gtcaccatcaagattccaatcagtggtaaacctgatcctgcagtcacatggcagaaggga
caagaaatactgaataacacagcatatcatcaagtgattgtaacaagatcctttacatcc
cttgtgttccaaaagggagtgcaaaagaaagatgctggttactatataatttgtgccaag
aacagatttggtgttgataaacaaacagttgaactcgatgttgctgatgtacctgatcca
ccaaaagatgttaaagtaagtgatattggaagagatttcatcacactcacatggactcct
ccaaatgatggtggaagtgatatcatcagctatatagtagagaagtgcccagtatctggt
gataggtggatccgtgttgcccagacatctgaaccacaacatactgtattgagcctattc
ggaaagaccaaataccagttccgtgttattgcagaaaacagatttggtctgagtaaccca
tctgtgccaactgaacctgtaacagcaagagaagacaagttagctattagaaattatgat
gaagaagtggatgaagaaagagaagttactaaagaagaagcacctcattccaaagttaag
aatgtgccatctctttacaaaatctctgaggaactagcacgatgtggacactttggtatt
gttcatcgttgtgttgaaattagctccaagaagactttcctggctaaactcattaaggtg
aaaggggctgatagagagctagttgcaagagagattgaaacactcaatattgcaaggcac
aagaacttactatatcttcatgagtccttcgatagcttggaggaatatgttcttatctat
gaattcatatcagggatggacatctttgaacgtcttggaacaaattttgacctcactgag
cgggaaattgttctgtacctgagacaagtttgccacgctctcaagttcctgcatggcctc
aactatggtcattttgacataagacctgaaaacattgtctacactacaagaaagagcagt
acaatcaagatcattgaaatgggccaagccagggtgctgacacctggagaaaatatcaga
attcagttcacagcacctgagtattttgcacctgaggtccacaatagtgattttgttacc
actgctacagacatgtggtcagttggagttctcgcatatgtgctccttagcggcatcaat
ccttttgctgctgaatcaactcaaaaaatgatcgaacacatttccagtgctgaatacata
tttgatagtgaggccttcaaatataccagtctcgaaggcatggacttcattgacaggctt
ctaattaaagaacgcaaacatcgtatgactgcatctgaggctctggaacatccttggctc
aagatgaaaatagaaaacattagttctaaagtcataaagactttaagacacagacgatat
taccagtcaataatcaagaaggagtggagcactgttatttcagcagctcgtgttgcctat
ggcggtggttacagaaaccagagaaatgtttcaattggcagagtgaaaattggacatcca
gaacaaggcctgagagcaggtcctgtcatgcatggctctgctgaattaggtggtcatgtt
cgttttatgtgcatcattgaaaactatgacaagactacggaggtggcctggtactttggc
tctcgtaaattgacagcaagtcataagtatgaaatcagctatgccaatggagttgcaagc
atatatgtgaaagacattgaagaatgtgatgatggactatacagatgcaaggttgttagt
gaagagagggaagacaacgcctatgcagagctgtttgttgagagtgtgaggtcctatcga
gaatacttcctgggacgttcactcaagaaacccaagcggagaattgatagaaccaaactt
ctacaaaggccacctgagtttactctgccactgtacaattgttcagcatatattggagag
gatgtacgctttggtgtaacaataactgttcatccagaaccacaggttacttggctgaag
gcaggacacagaatcaagcctgatcctacaaaatacacgtttacaactgacaagggtctt
tatcaactaatgattcacaatgttgaacctgatgatgatggtgaatataccgttgtggca
aataacaagtttggtgaagacagctgtaaggcacgcttaacagtaagacatcaccctgtt
gctgaggacacaatgaggccaatgttcagacgcctcttagcaaatattgattgtgttgag
ggagagagtgtacattttgatttgagagtgtcaggaacaccgacacctactctgaaatgg
gaaaaagatggaaagcctcttgaatttagaccacaagttgaacttgttcaagaagatgtg
ggttattatgttctccatattagagaaacacttattgaggattctggcacctacagagtt
actgcaacaaactctgctggttcagcaagttgccaagccacactcaaggttgaacgccta
acttatattaggagggagttcaagagtgaggaagataagcagatatacatacaaaaccaa
ataaaaaagacactaaaaatggcacaagaattctcaacagcagaagtgactacacttaat
cctgtagcacaagaggcactgaaagaagcggctgaactgtacaaacctgcagtgagtacc
aagaatgtgcagggtgagtttgatatctctgacaaagaagataaggaaattaagagaatt
aaagaagaaagtaggaagatcaggatgccttatgaaattccagaagctcgtgtacatgat
ccaactgttcttgaggaagacatgaatattaaatattttgtgcctttatctgacatgaag
tggtacaagaaacttcgcgatcaatacgaaatttctgaacgcatggagagagttgtgcag
aagagacagaaacgcatccgactttccagatgggaacagttctatgtcatgccacttcca
agaattactgatcaatacaggccaagatggcgtattccaaagcttacactagatgatttg
gaaactgtaagaccagctaggcgctcaccatctcctgaatcagacctcttccgacaaaga
aggcattccctgggggatctttcagatgaagaactcctccagcctgtagaagattatctg
acaaagaggagaattgaagaagagaagcaacagcttgaggaggaactggaacttggcttc
tctgcctctcctccaagtggtagccctgttcgttttgaactgcatgcactacgctataca
tcacctaggattatgcacaaagctgaagtgaaacacacagaggaaacaaaacatgcagtg
acaccaataaaacctagtggttctccaccccccctttcccatttcatgagaaggaggaga
tctctgtctccaacgtatattgaattgatgcgtcctgtctctgaattgataagaccatcc
cgggtgccagtggaatatgaaggtgaggcaattgaaaggaggtcacccactcctgagagg
acacgaccacgttcccctagtcctgtgtctcctgaaagaagatcatcgagatcttcctct
agatttgaaagatctgcaaggtttgacatcatgtctagatatgaggcaagaaaagctgct
ttgaaatctgagcgcaagtatcaagttgtaacacaacaaccatttagccttgaccatgcc
cctcgaatcacagttagaatgcgttcacaccgtgtaccatgtggtcaggacactaaattc
acattgaatgtccaatcaaggccagaagctgaaatccagtggttccataatggacaacag
attcaagagagcagcaaataccactttacagacatgagtggtgtcttaaccctccagatt
actgattgccaggcagaggatagtggcacataccgtgctgtctgtaccaactctaaggga
gaagcatctgactatgcaactctcgatgtatcaggaggagcatttactacatattcctca
agacgcaaagatgaggaagctccagcggcatttgtacctgaagtgataaagacagactat
taccacacatcatcaatcagggcatcttctgcctctagaacacacatagagatcaaagaa
accaaaacaaaacttactgagagacatgaagtttctgggtttgaaaaatatgagtctgaa
agacttgcatcatctcctgtcagacatgcatcgactgaatacctgtcatctgcttcatat
tcatcctcagaacgacatgtatcagctgaatataaggcaaaatctgttgagtcctcagct
acagcaagcattactgctaggaaagtcaaagccaccctgtcagcaaaaatactcaccaaa
ccacactctctaacagtatcattgggtgagtctgcaagatttacctgtgatattgatggc
gagccagcaccaagtgtcacatggatgcatgggcaacacactattgtcacttctcatcgt
gtacatgtgacaacaacacaatacaagtctacatttgaaatatcctctgtagagtactct
gatgaaggcagctacacagtagtggtagaaaattcagagggaaggcaagaggcaaagttt
accttaaacatctccaagccaccaacaaaagaggaggctgttgcaccatcccctccagtt
aaatctcttgagccagcagtgaagtcacctgaactttcagtgatgtcaccaacaacttct
gtagaatcaccaggaccttcagtgaaatttcgtacaccacctgtgacatctccagagcca
tcagttaagtctccagagcctttggtgaaatcaccagaatctaccggagtcaagtctcct
gaaccacaaattaagtcacccgagggtgtcaaatcgccactacgagtcaagtctcctgag
cctagtactgctgctccaagagttaagtcacctgtccctgcaaagccctcagaagcaatt
acgtcccctcttaggattaaatctcccacagccctgaagtctcctgaaccagtagcatct
cctccaagagtgaaatcgccacctccagttaagtctccagagctaagaacctcaccacag
agagttaaatctcccacaggcatgaagtcaccagagccaatcacctctcctcaaagagta
aaatccccaccagcagccaagtctcctgagccgatcatttcaccaaaaagggttaaatct
ccactcactgtgaaatcaccaactccttcaaaggaagcacccccaaagatcctccagcaa
cttaaagctgaggcctctgaagacaaggtgaagatgatctgtgttgctgaatgctctgta
agggacgttgtgtggtacaaagatggcaggagacttagtcacagtagccattatcagatc
catacttctgctgatggcacttgctgtctctatatatcggatgtgtctgagagggatcag
ggtgaatattcctgtgaaataatcgcagagagtggagcagtctcaaaaacatcattctcc
ttctttggtcaagtgttccagtccatctacacaaaaataacaacatttgtgtctgcacac
atggctgttaaagaatcagtgtcctcaaaggcccatgagggggttgaaatgcttaagaaa
gagagtgccactctcagcaaaatgcatgagagtttctcttcaaaatccgtccacatggag
agcacaatgcaagaaacatcgttcagcagttccaccatggctgaaatgaaatttgaaaca
atgtcaatgtccagcatgtcctccatgacttctgaatcagtgtatgctatgagctcaagc
agtatgatgtcaagtcactcacatgctgagggatcctcaataagagccactctgctcagt
ggtcaaggttcagcaccaaaaattgaagccctacctgaagacatcagcattgaacctggg
aaggttttgaccatagcatgtgcattctctggagagccttctccacacattgagtggtct
tgtggtggaaaaactatttcaactgcagaagagagtggaagattccacattgagactacg
gaggacctgacgacactcataatcactagtgtaaaatctagtgacgctggggtgtacacc
ctcaaactttccaatgagcatgggtctgatatggcaactgtcaccattagcattcgttca
ctataa

DBGET integrated database retrieval system