KEGG   Pontibacter korlensis: PKOR_02185Help
Entry
PKOR_02185        CDS       T03841                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
pko  Pontibacter korlensis
Pathway
pko00770  Pantothenate and CoA biosynthesis
pko01100  Metabolic pathways
Module
pko_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PKOR_02185
Enzymes [BR:pko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     PKOR_02185
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     PKOR_02185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AKD02159
UniProt: A0A0E3ZBR6
Position
complement(535266..535928)
Genome map
AA seq 220 aa AA seqDB search
MTQKSFNGKTVLLTAGPTHEPIDPVRFIGNHSTGKMGYALAECFAAMGAKVKLVSGPTNL
QTYHANIKVKHVLTAEEMYKAVLKYAEAADVWVFAAAVADYRPKTVADRKIKKAGDELTI
ELVKNVDIAAALGRQKEEWQFSVGFALETDNENSNAREKLRKKNLDMIVLNSLNDPGAGF
AHDTNKITIIEEHATHSFELKSKKEVAQDIVNLIWERIYG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgacacaaaaatcgtttaacggtaaaacagtactcctcacagcaggaccgacacatgaa
cccattgacccggtacgctttatcgggaaccactctacaggtaaaatgggttacgcattg
gcagagtgttttgcagcgatgggagcaaaagtgaaattagtctctggcccaactaacctg
cagacgtaccacgctaacattaaggttaagcatgtacttaccgccgaggagatgtacaag
gcggtgctaaagtatgccgaagctgctgatgtgtgggtatttgccgccgctgtagccgat
tacaggcctaaaacggttgccgacaggaaaataaaaaaagccggcgacgagctaacaata
gagttagtgaagaacgttgatattgcagcggcattgggtaggcagaaagaagaatggcag
ttttcggtaggctttgccctggaaacagacaatgaaaattccaatgcccgcgaaaagctg
cgcaaaaagaacctcgatatgattgtgctaaactctctgaacgatcctggggcaggcttt
gcgcacgatacaaataaaataacgataattgaagagcacgccactcatagctttgagctg
aagtcgaagaaggaggtggcacaggatatagtaaacttaatctgggagcggatatatggc
taa

DBGET integrated database retrieval system