KEGG   Parvibaculum lavamentivorans: Plav_3422
Entry
Plav_3422         CDS       T00580                                 
Name
(GenBank) putative secreted protein
Organism
pla  Parvibaculum lavamentivorans
SSDB
Motif
Pfam: TrbI UPF0242 ZapB Golgin_A5 Pex19 FUSC
Other DBs
NCBI-ProteinID: ABS65025
UniProt: A7HYP2
Position
3658073..3659482
AA seq 469 aa
MRSNGLLKWLMIPVALLVLFIGVRLFSGGGPSTLSQADAGSQLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNKSQREENQRLRQRENSIDQRINAALEAERSNLRRDQQ
QAASERQQTEGLLADLQRRLEAIGGRGGGHADLPVGLGLRDGDEAGMEGGVRWVEPDDAK
KAEARGSSSGAMSFPTSFGPAQRTLETTAETVANAGARAAGVKTAKAVYTVPTNSTLMGS
VAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLSCVR
GQVRSITFVFHDGTIRTIPEDREGNQQNNQQRDGLGWISDPYGIPCVSGERRSNAQQYLG
SQALITAAGAGVASLIESDSGQMSYVGSDGSIGTVGISGQEAVGRILAGGVQEMSNWVNK
LYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELD
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggactcctgaagtggctgatgatcccagtggccctcctggtgctgttc
atcggcgtccgtctgttctcgggcggcggaccttcgacactttcccaagccgacgcgggg
agccagctcacgcccgaagagatgaaggcgctgggcatcgagggcgataccccgcgcgat
accgtcgccacgctggtcgcgcaggtcaagcaactgcgcaccgagcttcagaccgcgctg
tccgacaacaagtctcagcgcgaggaaaaccaacgcctgcgccagcgcgagaactcgatc
gatcagcgcatcaacgccgcgctcgaagccgagcgttccaacctgcggcgcgaccagcag
caagccgcgagcgagcgccagcaaaccgaaggcttgctcgcggacttgcagcgacgcctg
gaggcgatcggcggtcgtggcggcggccatgccgacctgccggtgggcctgggactgcgc
gacggcgacgaggccgggatggaaggcggcgtgcgctgggtggaaccggacgacgcgaag
aaggctgaggcgcgcggctcgtccagtggcgccatgagctttccgacgagctttggaccg
gcgcagcgcacgctggaaaccacggcggaaaccgtggcgaacgcgggcgcacgcgccgcc
ggcgtcaagaccgccaaggctgtttatacggttccgacaaactccaccctcatgggatcg
gtggcgatgaccgcgctaatcggccgtgtgccgatcgacggcaccgtgaacgacccgtac
cccttcaaagtcctggtgggccccgacaacctcacggccaacggcatcgatattcccgac
gtggcgggcgccgtgttcagcggcacagcctcgggcgactggacgctctcgtgcgtgcgc
ggccaggtgcgcagcattacgttcgtctttcatgacggaaccatccgcaccattcccgag
gaccgcgagggcaaccagcagaacaaccagcaacgcgatggcctgggctggatcagcgat
ccctatggcattccctgcgtcagtggggagcggcgcagcaacgcccagcagtacctcggt
tcgcaggccctgatcaccgcggccggtgccggcgtggcctcgctcatcgaaagcgacagc
ggccagatgtcctacgtcggctcggacggctccatcggcactgtgggcatcagtggtcag
gaggccgtgggccggattctcgccggtggcgtccaggaaatgtcgaactgggtcaacaag
ctctacgggcaggccttcgccgccgtctatgtgcagcccggcgcgaaagtcgctgtccac
ctcgaaaaaccccttgccatcgacttcgaccccgagggtcgcaaggtcgatcaccgcgca
ggagaaagccatgctctcgaacttgactga

DBGET integrated database retrieval system