KEGG   Polaromonas naphthalenivorans: Pnap_2479
Entry
Pnap_2479         CDS       T00459                                 

Definition
(GenBank) dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00626  Naphthalene degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Pnap_2479
Enzymes [BR:pna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     Pnap_2479
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ABM37783
UniProt: Q3S4C4
Position
complement(2617087..2618124)
AA seq 345 aa
MTRKTSKATRLTAEDIQGAWVIMPTPSTPDASDWRSTHTVDLDETARIVEELIAAGVNGI
LSHGTFGECATLTWEEKRDFVSTVVETARGRVPYFCGTTALNTREVIRQTREVMDIGAQG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPDAAIAVYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERMTAFWSSGSMCGPATALMLRD
AVTQAKTTGDWTKAKAISDDMRAADATLFPRGDFSEFSKYNIGLEKARMDEAGWLKAGPC
RPPYTLVPDEYLAGARKSGNAWAALHTKYAEELKKTKTATGSKKK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgacaagaaagaccagcaaagcgacgcgcctgactgcagaggatattcaaggcgcatgg
gtcattatgccgaccccctccactccggatgcttcggactggcgcagcacgcacacggtt
gatctcgacgagacggcccggatcgtcgaggagttgatagcggccggggtcaatggcatt
ctaagccacggcacttttggtgaatgcgcgacgctgacgtgggaagagaagcgggatttt
gtttcaacggtcgtcgaaaccgcccgtggtcgagtgccctacttctgcggcacaacagcc
ttgaatacccgtgaagttatacgccagacccgcgaagtgatggacattggtgcccaagga
accatgctcggcgtgccgatgtgggtgaagatggatctgcccaccgccgtgcagttttat
cgcgatgtggcggaagcggtgccagatgctgccatcgctgtttatgccaacccggaggct
ttcaaatttgattttcctcgcccgttttgggccgaaatgtccaaaatcccgcaagttgtt
acagccaagtacttgggcatcggaatgctggacttggatctgaaattggctccaaatatt
cgcttccttccgcatgaggatgactattacgctgcggcccgaatcaatcctgagcgcatg
accgccttctggtccagcggctccatgtgcggtccagcgactgccctcatgcttcgtgat
gcggtgacacaggccaagacgaccggtgactggaccaaggccaaggccatttcagatgac
atgcgcgctgccgacgccacactgtttccacgcggcgatttctcggaattctcgaaatac
aacattggtctcgaaaaagcacgaatggacgaggcgggttggctcaaagcggggccgtgc
cggccaccctatacgctggtaccagatgaataccttgcaggtgctcgaaaatcaggcaac
gcctgggccgcactgcataccaagtacgccgaggaattgaagaaaaccaaaacggcaacc
ggctcgaaaaagaagtga

DBGET integrated database retrieval system