KEGG   Pongo abelii (Sumatran orangutan): 100174088Help
Entry
100174088         CDS       T01416                                 

Gene name
ST6GAL1
Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00510  N-Glycan biosynthesis
pon00514  Other types of O-glycan biosynthesis
pon01100  Metabolic pathways
Module
pon_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100174088 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    100174088 (ST6GAL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pon01003]
    100174088 (ST6GAL1)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     100174088 (ST6GAL1)
Glycosyltransferases [BR:pon01003]
 Terminal extension
  Sialyltransferase
   100174088 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100174088
NCBI-ProteinID: NP_001127059
Ensembl: ENSPPYG00000014388
UniProt: Q5NVS9
Position
3
AA seq 406 aa AA seqDB search
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAIGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFPVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYEGPGPGIKFSAEALRCHLWDYVNVSMVEATDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKSYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacttgaagaaaaagttcagctgctgcgtcctggtctttcttctgttt
gcagtcatctgtgtgtggaaggaaaagaagaaagggagttactatgattcctttaaattg
caaaccaaggaattccaggtgttgaagagtctggggaaattggccatagggtctgattcc
cagtctgtatcctcaagcagcacccaggacccccacaggggccgccagaccctcggcagt
ctcagaggcctagccaaggccaaaccagaggcctccttcccggtgtggaacaaggacagc
tcttccaaaaaccttatccctaggctgcaaaaaatctggaagaattacctaagcatgaac
aagtacaaagtgtcctacgaggggccaggaccaggcatcaagttcagtgcagaggccctg
cgctgccacctctgggactatgtgaatgtatccatggtagaagccacagattttcccttc
aatacctctgaatgggagggttatctgcccaaggagagcattaggaccaaggctgggcct
tggggcaggtgtgctgttgtgtcgtcagcgggatctctgaagtcctcccaactaggcaga
gaaatcgatgatcatgacgcagtcctgaggtttaatggggcacccacagccaacttccaa
caagatgtgggcacaaaaactaccattcgcctgatgaactctcagttggttaccacagag
aagcgcttccttaaagacagtttgtacaatgaaggaatcctaattgtatgggacccatct
gtataccattcagatatcccaaagtggtaccagaatccagattataatttctttaataac
tacaagagttatcgtaagctgcaccccaatcagcccttttacatcctcaagccccagatg
ccttgggagctatgggacattcttcaagaaatctccccagaagagattcagccaaacccc
ccatcctctgggatgcttggtatcatcatcatgatgacgctgtgtgaccaggtggacatt
tatgagttcctcccatccaagcgcaagactgacgtgtgctactactaccagaagttcttt
gatagtgcctgcacgatgggtgcctaccacccgctgctctatgagaagaatttggtgaag
catctcaaccagggcacagatgaggacatctacctgcttggaaaagccacactgcctggc
ttccggaccattcactgctaa

DBGET integrated database retrieval system