KEGG   Pongo abelii (Sumatran orangutan): 100431256
Entry
100431256         CDS       T01416                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04080  Neuroactive ligand-receptor interaction
pon04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100431256 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100431256 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 100431256
NCBI-ProteinID: XP_002832145
UniProt: A0A2J8WWN7
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg
tgtggagggtccctgatgccgcttcccgatgggaatgggctggaagagggcaatgtccgc
cacctggtgcagcccagagggtcgaggaatgggccagggccctggcagggaggtcggagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system