KEGG   Pongo abelii (Sumatran orangutan): 100447050
Entry
100447050         CDS       T01416                                 
Symbol
ADNP
Name
(RefSeq) activity-dependent neuroprotector homeobox protein
  KO
K22591  activity-dependent neuroprotector homeobox protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100447050 (ADNP)
   03036 Chromosome and associated proteins [BR:pon03036]
    100447050 (ADNP)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ZF
    100447050 (ADNP)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100447050 (ADNP)
SSDB
Motif
Pfam: ADNP_N Homeodomain zf-C2H2_4 Homeobox_KN zf-Di19 zf_C2H2_ZHX zf-C2H2
Other DBs
NCBI-GeneID: 100447050
NCBI-ProteinID: XP_002830462
Ensembl: ENSPPYG00000011130
UniProt: A0A6D2WGI4
Position
20:complement(47368305..47410842)
AA seq 1102 aa
MFQLPVNNLGSLRKARKTVKKILSDIGLEYCKEHIEDFKQFEPNDFYLKNTTWEDVGLWD
PSLTKNQDYRTKPFCCSACPFSSKFFSAYKSHFRNVHSEDFENRILLNCPYCTFNADKKT
LETHIKIFHAPNASAPSSSLSTFKDKNKNDGLKPKQADSVEQAVYYCKKCTYRDPLYEIV
RKHIYREHFQHVAAPYIAKAGEKSLNGAVPLGSNAREESSIHCKRCLFMPKSYEALVQHV
IEDHERIGYQVTAMIGHTNVVVPRSKPLMLIAPKPQDKKSMGLPPRIGSLASGNVRSLPS
QQMVNRLSIPKPNLNSTGVNMMSSVHLQQNNYGVKSVGQGYSVGQSMRLGLGGNAPVSIP
QQSQSVKQLLPSGNGRSYGLGSEQRSQAPARYSLQSANASSLSSGQLKSPSLSQSQASRV
LGQSSSKPAAAATGPPPGNTSSTQKWKICTICNELFPENVYSVHFEKEHKAEKVPAVANY
IMKIHNFTSKCLYCNRYLPTDTLLNHMLIHGLSCPYCRSTFNDVEKMAAHMRMVHIDEEM
GPKTDSTLSFDLTLQQGSHTNIHLLVTTYNLRDAPAESVAYHAQNNPPVPPKPQPKVQEK
ADIPVKSSPQAAVPYKKDVGKTLCPLCFSILKGPISDALAHHLRERHQVIQTVHPVEKKL
TYKCIHCLGVYTSNMTASTITLHLVHCRGVGKTQNGQDKTNAPSRLNQSPSLAPVKRTYE
QMEFPLLKKRKLEDDSDSPSFFEEKPEEPVVLALDPKGHEDDSYEARKSFLTKYFNKQPY
PTRREIEKLAASLWLWKSDIASHFSNKRKKCVRDCEKYKPGVLLGFNMKELNKVKHEMDF
DAEWLFENHDEKDSRVNASKTADKKLNLGKEDDSSSDSFENLEEESNESGSPFDPVFEVE
PKISNDNPEEHVLKVIPEDALESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQD
DVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQ
GDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNM
TDGVAEPMHGSLAGVKLSSQQA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgttccaacttcctgtcaacaatcttggcagtttaagaaaagcccggaaaactgtgaaa
aaaatacttagtgacattgggttggaatactgtaaagaacatatagaagattttaaacaa
tttgaacctaatgacttttatttgaaaaacactacatgggaggatgtaggactgtgggac
ccttcacttacgaaaaaccaggactatcggacaaaacctttctgctgcagcgcttgtcca
ttttcctcaaaattcttctctgcctacaaaagtcatttccgaaatgtccatagtgaagac
tttgaaaataggattctccttaattgcccctactgtaccttcaatgcagacaaaaagact
ttggaaacacacattaaaatatttcatgctccgaacgccagcgcaccaagtagcagcctc
agcactttcaaagataaaaacaaaaatgatggccttaaacctaagcaggctgacagtgta
gagcaagctgtttattactgtaagaagtgcacttaccgagatcctctttacgaaatagtt
aggaagcacatttacagggaacattttcagcatgtggcagcaccttacatagcaaaggca
ggagaaaaatcactcaatggggcagtccccttaggctcaaatgcccgagaagagagtagt
attcactgcaagcgatgccttttcatgccaaagtcctatgaagctttggtacagcatgtc
atcgaagaccatgaacgtataggctatcaggtcactgccatgattgggcacacaaatgta
gtggttccccgatccaaacccttgatgctaattgctcccaaacctcaagacaagaagagc
atgggactcccaccaagaatcggttcccttgcttctggaaatgtccggtctttaccatca
cagcagatggtgaatcgactctcaataccaaagcctaacttaaattctacaggagtcaac
atgatgtccagtgttcatctgcagcagaacaactatggggtcaaatctgtaggccagggt
tacagtgttggtcagtcaatgagactgggtctaggtggcaatgcaccagtttccattcct
cagcaatctcagtctgtaaagcaattacttccaagtggaaatggaaggtcttatgggctt
gggtcagagcagaggtcccaggcaccagcaagatactccctgcagtctgctaatgcctct
tctctctcatcgggccagttaaagtctccttccctctctcagtcacaggcatccagagtg
ttaggtcagtccagttccaaacctgctgcagctgccacaggccctcccccaggtaacact
tcctcaactcaaaagtggaaaatatgtacaatctgtaatgagctttttcctgaaaatgtc
tatagtgtgcacttcgaaaaagaacataaagctgagaaagtcccagcagtagccaactac
attatgaaaatacacaattttactagcaaatgcctctactgtaatcgctatttacccaca
gataccctgctcaaccatatgttaattcatggtctgtcttgtccatattgccgttcaact
ttcaatgatgtggaaaagatggccgcacacatgcggatggttcacattgatgaagagatg
ggacctaaaacagattctactttgagttttgatttgacattgcagcagggtagtcacact
aacatccatctcctggtaactacatacaatctgagggatgccccagctgaatctgttgct
tatcatgcccaaaataaccctccagttcctccaaagccacagccaaaagttcaggaaaag
gcagatatccctgttaaaagttcacctcaagctgcagtgccctataaaaaagatgttggg
aaaaccctttgccctctttgcttttcaatcctaaaaggacccatatctgatgcacttgca
catcacttacgagagaggcaccaagttattcagacggttcatccagttgagaaaaagctc
acctacaaatgtatccattgccttggtgtgtataccagcaacatgaccgcctcgactatc
actctgcatctagttcactgcaggggtgttggaaagacccaaaatggccaggataagaca
aatgcaccctctcggcttaatcagtctccaagtctggcacctgtgaagcgcacttacgag
caaatggaatttcccttactgaaaaaacgaaagttagaggatgatagtgattcacccagc
ttctttgaagagaagcctgaagagcctgttgttttagctttagaccccaagggtcatgaa
gatgattcctatgaagccaggaaaagctttctaacaaagtatttcaacaaacagccctat
cccaccaggagagaaattgagaagctagcagccagtttatggttatggaagagtgacatc
gcttcccattttagtaacaaaaggaagaagtgtgtccgtgattgtgaaaagtacaagcct
ggcgtgttgctggggtttaacatgaaagaattaaataaagtcaagcatgagatggatttt
gatgccgagtggctatttgaaaatcatgatgagaaggattccagagtcaatgctagtaag
actgctgacaaaaagctgaaccttgggaaggaagatgacagttcctcagacagttttgaa
aatttggaagaagaatccaatgaaagtggtagcccttttgaccctgtttttgaagttgaa
cctaaaatctctaacgataacccagaggaacatgtactgaaggtaattcctgaggatgct
ttagaatctgaggagaagctagaccaaaaagaggatggttcgaaatacgaaactattcat
ttgactgaagaaccaaccaaactaatgcacaatgcatctgatagtgaggttgaccaagac
gatgttgttgagtggaaagacggtgcttctccatctgagagtgggcctggatcccaacaa
gtgtcagactttgaggacaatacctgcgaaatgaaaccaggaacctggtctgacgagtct
tcccaaagcgaagatgcaaggagcagtaagccagctgccaaaaaaaaggctaccatgcaa
ggtgacagagagcagttgaaatggaagaatagttcctatggaaaagttgaagggttttgg
tctaaggaccagtcacagtggaagaatgcatctgagaatgatgagcgcttatctaacccc
cagattgagtggcagaatagcacaattgacagtgaggatggggaacagtttgacaacatg
actgatggagtagctgagcccatgcatggcagcttagccggagttaaactgagcagccaa
caggcctaa

DBGET integrated database retrieval system