KEGG   Pongo abelii (Sumatran orangutan): 100455869
Entry
100455869         CDS       T01416                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X3
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100455869 (AHRR)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100455869 (AHRR)
SSDB
Motif
Pfam: PAS PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 100455869
NCBI-ProteinID: XP_009238804
Position
5
AA seq 632 aa
MLRGLRRGQCCPGQMSVVQEQSSRQPAAGAPSPGDSRPLAGSAVLEGRLLLESLNGFALV
VSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQP
PPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLK
FLFGQKKKAPSGAMLLPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAVTTDAKVK
AATSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLD
PKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPS
LRPMPRGSCLPYPCVQGTFRNSPISHPLSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQ
GSLQHRLPQPGAQRFATRGYPMEDVKLQGVPMPPGDLCGPTLLLDVPIKMEKDSGSEDAA
DGYVPSQVWLGATDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPQGRATAGRS
RELTPFHPAHCACLEPTHGLPQPEPPHQLCARGRGEQSCACRAAEAAPVVKREPLDSPHW
ATHSQGVVPGMFPKSALATLVPPQASECTFLP
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgctgcgtggcctgcggaggggtcagtgctgcccaggccagatgtcagtcgtgcaggag
cagagctcacggcagccggcggccggcgccccctcgcccggagacagccgtcctcttgca
gggtctgctgtgctggaaggaaggctgctgttggagtctcttaatggctttgctctggtc
gtgagtgcagaagggacgatattttatgcgtcagcaacgatcgtggactatctgggcttc
catcagacggatgtaatgcaccagaacatttacgactacatccacgtggacgaccgccag
gacttctgccggcagctccactgggccatggaccctccccaggtggtgtttgggcagccc
ccgcccttggagacaggagatgacgctatcctggggaggctgctcagggcccaggagtgg
ggcgcaggcgcacccaccgagtactcggccttcctgacccgctgcttcatctgccgtgtg
cgctgcctgctggacagcacctcgggcttcctgacgatgcagtttcaaggaaaactaaaa
ttcctgtttggacagaagaagaaggcgccgtcaggagccatgctcctgccgcggctgtcg
ctgttctgcatcgcggcacccgttctcctcccctccgcagcggagatgaaaatgaggagc
gcgcttctgagggcaaaacccagggcagacaccgcagtcaccacggatgcaaaagtaaaa
gccgccaccagtctgtgcgaatcggaactgcatggaaaacccaattactcagcaggaagg
agcagcagagagagcggcgttttggtgctcagggaacagactgacgctggccgatgggca
caggttcctgccagggccccatgcctgtgcctccggggtggccccgaccttgtcctcgac
cccaaggggggctcaggggacagggaggaggagcagcacaggatgctgagcagggcctct
ggagtgacagggcggagggagactccaggacccacaaagcccctgccctggacagcagga
aagcacagtgaggatggtgccaggccaaggctgcagcccagcaagaatgacccaccctcc
ctgcgccccatgccccgcggctcctgcctgccctacccgtgtgtccagggcactttcagg
aactcacccatctctcacccgctgagcccgtcccccagtgcctactccagccggaccagc
agacccatgcgggatgtcggtgaggaccaggtgcaccctcccctctgccactttccccag
gggagcctgcagcaccggctccctcagcctggagctcagcgttttgccacgaggggctat
cccatggaggacgtgaagctgcaaggtgtaccgatgcctccgggggacctgtgcggtccg
acgctgctgctagatgtgcccatcaagatggagaaggactctgggtctgaggatgctgca
gatggctatgtgcccagccaggtgtggctgggggccactgacaggagccatccagccacc
ttccctaccaggatgcacctgaaaacagagccagactctcggcaacaggtgtacatctcg
cacctggggcacggcgtgcggggggctcagccccaggggagggccactgctgggcgcagc
agggagctgacccctttccaccctgcacactgtgcttgcctggagcccacgcacggcctt
ccccagccggagcctccccaccagctctgtgcacggggccgaggtgaacagtcctgcgcc
tgcagagctgctgaggctgcccctgtggtcaagcgggagcccttggattcgccccactgg
gctactcacagccagggagtggtgcccgggatgtttcccaaaagtgccttggccacgctg
gtcccgccccaagcttcggagtgcacattcctgccatag

DBGET integrated database retrieval system