KEGG   Pongo abelii (Sumatran orangutan): 100458219Help
Entry
100458219         CDS       T01416                                 

Gene name
HSD17B6
Definition
(RefSeq) 17-beta-hydroxysteroid dehydrogenase type 6
  KO
K13369  17beta-estradiol 17-dehydrogenase / all-trans-retinol dehydrogenase (NAD+) / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.105 1.1.1.239]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon00830  Retinol metabolism
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100458219 (HSD17B6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100458219 (HSD17B6)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100458219 (HSD17B6)
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     100458219 (HSD17B6)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     100458219 (HSD17B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Motif
Other DBs
NCBI-GeneID: 100458219
NCBI-ProteinID: XP_009246204
Ensembl: ENSPPYG00000004673
UniProt: A0A2J8UHG0
Position
12
AA seq 317 aa AA seqDB search
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAAC
LTEKGAEQLRGQMSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPIT
LCEWLNTEDFMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSK
YGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNLTQSLERMKQRWKEAPKHIKETYGQ
QYFDAFYSIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTS
LADYILTRSWPKPAQAV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctacctggcggccttcgtgggcctgtactaccttctgcactggtaccgggag
aggcaggtggtgagccacctccaagacaagtatgtctttatcacgggctgtgactcgggc
tttgggaacctgctggccagacagctggatgcacgaggcttgagggtgctggctgcgtgt
ctgacggagaagggggccgagcagctgaggggccagatgtctgacaggctggagacggtg
accctggatgttaccaagatggagagcatcgctgcagctactcagtgggtgaaggagcat
gtgggggacagaggactctggggactggtgaacaatgcaggcattcttacaccaattacc
ttatgtgagtggctgaacactgaggactttatgaatatgctcaaagtgaacctcattggt
gtgatccaggtgaccttgagcatgcttcctttggtgaggagagcacggggaagaattgtc
aatgtctccagcattctgggaagagttgctttctttgtaggaggctactgtgtctccaag
tatggagtggaagccttttcagatattctgaggcgtgagattcaacattttggggtgaaa
atcagcatagttgaacctggctacttcagaacgggaatgacaaacctgacacagtcctta
gagcgaatgaagcaaagatggaaagaagcccccaagcacattaaggagacctatggacag
cagtattttgatgccttttacagtatcatgaaggaagggctgttgaattgtagcacaaac
ctgaacctggtcactgactgcatggaacatgctctgacatcggtgcatccgcgaactcga
tattcagctggctgggatgctaaatttttcttcatccctctatcttatttacctacatca
ctggcagactacattttgactagatcttggcccaaaccagcccaggcagtctaa

DBGET integrated database retrieval system