KEGG   Komagataella phaffii: PAS_chr3_0924Help
Entry
PAS_chr3_0924     CDS       T01092                                 

Definition
(RefSeq) Ubiquitin conjugating enzyme, involved in the ER-associated protein degradation pathway
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
ppa  Komagataella phaffii
Pathway
ppa04120  Ubiquitin mediated proteolysis
ppa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PAS_chr3_0924
   04120 Ubiquitin mediated proteolysis
    PAS_chr3_0924
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ppa04121]
    PAS_chr3_0924
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     PAS_chr3_0924
Ubiquitin system [BR:ppa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   PAS_chr3_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 8200276
NCBI-ProteinID: XP_002493161
UniProt: C4R5Z6
Position
3:1798113..1798616
Genome map
AA seq 167 aa AA seqDB search
MPPKSTAQRRLFKEYQQLSRDAPEGIIAGPLDEDDLFYWECLIEGPKDTPYENGVFSAQL
TFPKDYPLSPPKLKFNPPLIHPNIYADGTVCISILHPPGNDPLLYERPEERWSPVQSVEK
ILLSVASMLAEPNVESGANIDVCKIWRDDRPKFDAMVREQVRKSLGL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaatcaaccgctcaacgacggttattcaaggaataccagcagctatcccgt
gatgcccctgaggggataattgcgggccctctggatgaagatgatttgttttattgggaa
tgtctgatagagggaccaaaggatactccatacgagaatggggtattctctgctcaattg
acatttcctaaggattacccattgtcaccgcccaaactcaagttcaatccaccattgatt
cacccaaatatttatgcggatggaacggtttgcatttcaatcttacatcctccaggaaat
gatccattgctatacgaacgacctgaagaacgctggtctccggtgcaaagcgtcgagaag
attctacttagtgtagctagcatgctggctgaaccaaatgttgaaagcggtgccaacata
gatgtgtgcaagatatggagagatgacagaccaaaatttgatgctatggtcagagaacaa
gtcagaaagtcgctggggctgtga

DBGET integrated database retrieval system