KEGG   Pseudomonas putida ND6: ND061
Entry
ND061             CDS       T02170                                 

Gene name
nahE
Definition
(GenBank) 1,2-dihydroxybenzyl pyruvate aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00626  Naphthalene degradation
ppi01100  Metabolic pathways
ppi01120  Microbial metabolism in diverse environments
ppi01220  Degradation of aromatic compounds
Module
ppi_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ND061 (nahE)
Enzymes [BR:ppi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     ND061 (nahE)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AAP44192
UniProt: Q6XUU3
Structure
PDB: 
6DAO

Position
pND6-1:62027..63031
AA seq 334 aa
MSNKIMKTSRLTAEDINGAWTIMPTPSTPDASDWRSTATVDLEETARIVEELIAAGVNGI
LSMGTFGECATLTWDEKRDYVSTIVETIRGRVPYFCGTTALNTREVIRQTRELIDIGANG
TMLGVPMWVKMDLPTAVQFYRDVADAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLRLAPNIRFLPHEDDYYAAARINPERITAFWSSGAMCGPATAIMLRD
EVVRAKSTGDWAKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLKAGPC
RPPYNLVPEDYLAGAQKSGKAWAALHAKYSNELK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcgaataaaattatgaaaacgtcgcgtcttaccgccgaagatatcaacggcgcctgg
actataatgcccacaccctcgacgcctgatgcttctgattggcgcagcactgccaccgtg
gacttagaagagactgcccgcatagttgaagagctgattgcagctggtgtcaacggtatt
ctaagtatgggtacttttggtgagtgcgccacgttgacctgggatgaaaaacgtgattat
gtctcgacgattgtcgagaccattcgtggtcgcgtgccttatttctgtggcacgacagcc
ttaaatacccgagaagtcatccgccagacccgagagcttatcgatattggcgccaacggc
actatgctcggggtgccgatgtgggtgaagatggacctgcctacagcggttcagttctat
cgtgatgttgcagatgcggtaccagaggctgccattgcgatttacgccaaccccgaagca
ttcaagttcgacttccctcgcccattctgggcagagatgtccaaaattccgcaggtagtg
actgcgaagtatctaggcatcggaatgcttgacttggacctgagactggcacccaacatc
cgcttccttccccacgaagatgactattacgcggccgcacgcatcaatcccgagcgcata
accgcgttctggtcaagcggggccatgtgcggcccggctaccgccatcatgttgcgtgac
gaagtggtgcgggccaagagcaccggtgactgggccaaggccaaagccatctccgatgat
atgcgtgcagccgactcgacattgtttccgcgtggcgacttttcggagttctcgaagtat
aatatcgggcttgaaaaggcacggatggatgcggctggttggctcaaggctgggccctgc
cgtccgccctacaaccttgttccagaagactacctcgctggtgcacagaaatcaggcaag
gcttgggccgcgctgcacgctaaatacagtaatgaattgaagtag

DBGET integrated database retrieval system