KEGG   Pseudodesulfovibrio profundus: DPRO_1025
Entry
DPRO_1025         CDS       T05258                                 

Definition
(GenBank) Xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00230  Purine metabolism
pprf01100  Metabolic pathways
pprf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DPRO_1025
Enzymes [BR:pprf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DPRO_1025
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: SOB57912
UniProt: A0A2C8F7A2
Position
DPRO:1039714..1042083
AA seq 789 aa
MFKTKSVGQSVRQKDGAPRVTGDAKYYADVLLPDMLQTRILRSPYPAADIISIDTSEAEA
VPGVRLVMTHENFPKAFRKSLYYVGDLVAAVIATDATIAEEAMELIKVEYEKKKFVLNLE
DAINPDSPQVFEGVDNCHDWEFHYYMSDRDPETRLFKTKTQAEYNGFGDIDKGFAEADVV
VEQKGLKYAYCKSPAMEPRGCTAHYDGNKLNVYTHSQGLHDEKLCLAQALGINSSMLNYI
SPYTGSSFGGKNAFPLDRNIASHYLMVAGLATLELHKPVHCSYSREEEMLCGWSRGSIGD
VKVGFKKDGTLTTMDFFHWQECGAGGDKYPTKNAILATGAVLYSRNVEHQRSRIRYVHTN
RFCCNGWQGYGVPEGTYAVETTMDIAAYQMGIDPVEIRKKNCMRAGDIDSGWDPLTYKSA
YISSSGIRDCLDKGAEYVDWKNKWQHPREKTGRIRSGMGVAIFAMAAGRPGPGNSSEAMV
KVFPDGTAAFVCAVADIGQGQHTVQTQIVADVLGLPYEKIGLVCHDTDSTPFATLVASSC
GTWIQGWATYGAALDAKNKVLGLAAEKLGVPAEKLTMDENGIHVVGDRSKNISFSDAFGT
RGHYGGVHEVVGYYVHNSPTSINDKGEKKDGIYLPKEKGAQFITLDVDTETGIISNVQVV
MAQNVGKALNPKIVAGQMLGSRHGIENATLANDCIVDKRNGWLMTPNWVDYRHSTAMDCD
VTPLIVEKPGDPSHPLGATACGEGAACPTLASFSNALYNAIGVRILETPFTPEKILTALG
KIQDKRRKK
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgtttaagaccaaatccgtaggccagtccgtccgccagaaggatggcgccccccgcgtt
acaggcgatgcaaaatactatgcagatgtcttacttcccgacatgctgcagacccgcatc
ctgcgcagtccttatccggcagccgacatcatcagcatagacacctccgaagcagaagcc
gttccgggcgtaaggctcgtcatgacccatgagaacttccccaaggcgttccgcaaaagc
ctgtattatgtcggcgacctcgtggcagcagtcatagctaccgatgccaccattgccgaa
gaagccatggaactcatcaaggtcgaatacgaaaaaaagaaattcgttctgaacctcgaa
gacgccatcaacccggactctccccaggttttcgagggagtggacaattgccatgattgg
gaattccactactacatgagtgaccgcgatcccgaaacacgacttttcaaaaccaagact
caggcagagtacaacggttttggagatatcgataaggggtttgccgaagcagatgtcgtt
gtcgaacaaaagggtctcaaatacgcttactgcaaaagccccgcaatggagcctcgcggt
tgcaccgcccactacgacggcaacaagctcaatgtatacacccactcccagggactgcac
gatgagaaactctgtctggctcaggccctcggcatcaactccagtatgctcaattacatt
tcgccctacactggctccagctttggcggaaagaacgcattccctctggatcgcaacatc
gcatcccactacctgatggtggccgggcttgccactctggaactgcacaaacccgtacac
tgcagctactcaagagaagaagagatgctttgcggttggtcccgtggcagtattggtgat
gtcaaagtcggcttcaagaaagacggcacattaacgaccatggacttcttccactggcag
gagtgtggcgcaggcggagacaaatacccgaccaaaaatgcaatcctcgctaccggagca
gtcctttactctcgaaatgtcgagcaccaacgcagccggattcgctacgttcacaccaac
cgtttctgctgcaacggctggcagggatatggcgttcccgaagggacctacgcggtggaa
accaccatggatatcgctgcgtaccagatgggtatcgatccggtcgaaattcgcaagaag
aactgcatgcgcgcaggcgatatcgactccggctgggacccgctgacttacaaatccgcc
tatatctcttcctccggcatccgcgactgcctcgataaaggcgcagagtatgtggattgg
aaaaacaaatggcagcaccccagagaaaagacagggcgcatccgcagcggtatgggcgtg
gccatctttgccatggccgcaggtcgccccgggccgggcaactccagtgaagccatggtc
aaggttttcccagacggcactgcggccttcgtctgcgccgtcgcggacataggacagggc
cagcacaccgtgcagacccagatcgttgctgacgtcctgggcctcccttacgaaaagatc
gggctggtctgccacgatacagactccactccattcgccacactggtcgccagtagttgc
ggaacgtggattcagggctgggccacatacggtgcggcactggatgccaaaaacaaggtg
ctcggattggcagcagaaaagctgggagtaccggctgagaaactgaccatggatgaaaac
ggaatccatgtcgtgggcgacagaagcaagaacatatccttctcagacgcattcggcacc
cgtggccactatggcggcgttcatgaagtggtcggctactatgtccacaattctcccact
agcatcaatgacaagggggagaagaaggatggaatctaccttcccaaggaaaaaggtgct
cagttcatcacccttgatgtggatacagagaccggcatcatctccaacgttcaggtcgtg
atggcccaaaacgtgggtaaagcgctgaacccaaagatcgttgcaggacaaatgcttggc
tcacggcacggcattgagaacgcaacactggcaaacgactgcatcgtggacaagcgcaac
ggctggctcatgacacccaactgggtcgattaccggcactccactgccatggattgcgat
gtaactcccttgatagtcgagaagcccggtgatccgagtcacccgctcggagccacggcc
tgtggcgaaggcgcagcctgccccaccttggcctcattctccaacgccctgtacaacgct
attggcgtccgcattctggagacaccgttcacacctgaaaaaatcctcaccgcactgggc
aagatccaggacaaaaggaggaaaaaataa

DBGET integrated database retrieval system