KEGG   Pseudomonas protegens Cab57: PPC_2192Help
Entry
PPC_2192          CDS       T03613                                 

Definition
(GenBank) acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00010  Glycolysis / Gluconeogenesis
ppro00020  Citrate cycle (TCA cycle)
ppro00620  Pyruvate metabolism
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01120  Microbial metabolism in diverse environments
ppro01130  Biosynthesis of antibiotics
ppro01200  Carbon metabolism
Module
ppro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPC_2192
   00020 Citrate cycle (TCA cycle)
    PPC_2192
   00620 Pyruvate metabolism
    PPC_2192
Enzymes [BR:ppro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PPC_2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Ndr GCV_H Esterase PGAP1 DUF915 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: BAO61539
Position
2439043..2440155
Genome map
AA seq 370 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDAWLKEEGQSISKGDEVLDVETDKISSSVEAPFSGILRR
QIARQDETLAVGALLGIVVEGEASDAEIDAVIEQFQASFVPGDSADEDSGPAPQKVELGG
RLIRYFERGEGGTPLLLVHGFGGDLNNWLFNHEALAAGRRVIALDLPGHGESAKALQRGD
LDELSEVLLALLDHLDIPVAHLVGHSMGGAVSLNTARLAPDRVRSLTLIGSAGLGREING
DYLQGFVEASNRNALKPQLVQLFSNAELVNRQMLDDMLKYKRLEGVQAALGQLAGKLFAD
GRQQADLRPVVQDGPQPVLVIWGSDDRIIPVSHSADLKAQIEVLPGQGHMLQMEAAEQVN
RLILDFIQQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccataccctgaccatgcccaagtggggcctgtcgatgaccgagggccgg
gtcgatgcctggctcaaggaagaaggccagagcatcagcaagggcgatgaagtgctggac
gtggagaccgacaagatctccagcagcgtcgaggcgccgttctccggcatcctgcgtcgg
cagatcgcccgccaggacgagaccctggcggtgggcgcgctgttgggcatcgtggtcgaa
ggcgaggccagtgacgccgagatcgacgcggtgatcgagcagttccaggccagcttcgtg
cccggcgacagcgccgacgaagacagtggcccggcgccgcagaaggtcgagctgggcggc
cggctgatccgttatttcgagcgcggtgaaggcggtacgccgctgttgctggtgcacggc
tttggcggcgacctcaacaactggctgttcaaccacgaagccctggccgccgggcgccgg
gtgatcgccctcgacctgccgggccacggtgagtcggccaaggccctgcaacggggcgac
ctggatgaattgagcgaagtgctgctggcgctgctggatcacctggacattcccgtggcc
catctggtgggccactccatgggcggcgcggtgtccctcaacaccgcgcggctggcgccg
gaccgcgtgcgttccctgaccctgatcggcagcgccgggctgggccgcgagatcaacggc
gactacctgcaaggttttgtcgaggccagcaaccgcaacgccctcaagccgcagctggtg
cagctgttctccaacgccgagctggtgaaccggcagatgctcgacgacatgctcaagtac
aagcgcctggaaggggtgcaagcggccctcgggcagttggccggcaagctgtttgccgac
ggccgccagcaggccgacctgcgcccggtggtgcaggacggcccgcagccggtgctggtg
atctggggcagcgacgaccggatcattccggtgagccacagcgccgatctcaaggcgcag
atcgaggtgctgccggggcaggggcacatgctgcagatggaagcggcggagcaggtcaac
cgcctgatcctcgactttatccagcagcactga

DBGET integrated database retrieval system