KEGG   Pan paniscus (bonobo): 100968361Help
Entry
100968361         CDS       T02283                                 

Gene name
ILK
Definition
(RefSeq) integrin linked kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03320  PPAR signaling pathway
pps04360  Axon guidance
pps04510  Focal adhesion
pps05100  Bacterial invasion of epithelial cells
pps05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100968361 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100968361 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    100968361 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100968361 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100968361 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100968361 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100968361 (ILK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100968361 (ILK)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: TKL group
  MLK family
   100968361 (ILK)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100968361 (ILK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ank_5 Ank_4 Pkinase Ank_2 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 100968361
NCBI-ProteinID: XP_003819130
UniProt: A0A2R9ACD3
Position
11
AA seq 452 aa AA seqDB search
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgttgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtgaatgaacatggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgagagcgggcagagaagatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccacccgcactcggccccgaaatgga
accctgaacaaacactctggcattgacttcaaacagcttaacttcctgacgaagctcaac
gagaatcactccggagagctatggaagggccgctggcagggcaatgacattgtcgtgaag
gtgctgaaggttcgagactggagtacaaggaagagcagggacttcaatgaagagtgtccc
cggctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgccagtctcca
cctgctcctcatcctactctcatcacacactggatgccatatggatccctctacaatgta
ctacatgaaggcaccaatttcgtcgtggaccagagccaggctgtgaagtttgctttggac
atggcaaggggcatggccttcctacacacactagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggacatgactgcccgaattagcatggctgatgtc
aagttctctttccaatgtcctggtcgcatgtatgcacctgcctgggtagcccctgaagct
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaatatggagatt
ggaatgaaggtggcattggaaggccttcggcctaccatcccaccaggtatttcccctcat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgcaaagcgacccaaatttgac
atgattgtgcctatccttgagaagatgcaggacaagtag

DBGET integrated database retrieval system