KEGG   Pan paniscus (bonobo): 100969808
Entry
100969808         CDS       T02283                                 

Gene name
IL4R
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04151  PI3K-Akt signaling pathway
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05200  Pathways in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100969808 (IL4R)
   04151 PI3K-Akt signaling pathway
    100969808 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100969808 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100969808 (IL4R)
   04658 Th1 and Th2 cell differentiation
    100969808 (IL4R)
   04659 Th17 cell differentiation
    100969808 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100969808 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100969808 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100969808 (IL4R)
   04090 CD molecules [BR:pps04090]
    100969808 (IL4R)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IL2 receptor family
   100969808 (IL4R)
CD molecules [BR:pps04090]
 Proteins
  100969808 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 100969808
NCBI-ProteinID: XP_008958142
UniProt: A0A2R9C7J4
Position
16
AA seq 825 aa
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCVPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVYTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVF
CIVILVVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDCQEGREGIVARLTESLFLDLLGEENG
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPQLARHLEEVEPEMPCVPQLSEPT
TVPPPEPETWEQILRRNVLQHGAAAAPVSAPTSGYREFIHAVEQGGTQASAVVGLGPPGE
AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPHSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVVASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
APSGISEKIKPSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcctgcaggagcccacctgcgtctctgactacatgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaagcccacacgtgtgtccccgagaacaacgga
ggcgcggggtgcgtgtgccacctgctcatggatgacgtggtcagtgcggacaattataca
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctgacagtttacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccgtccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcagtgctataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcgttttc
tgcattgtcatcctggtcgtctgcctgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctcaggggtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaaagg
gatgaagatcctcacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccagtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgcgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggtagaggaagaa
aaagggagcttctgtgcatcgcctgagagcagcagggatgactgccaggagggaagggag
ggcattgtggcccggctaacagagagcctgttcctggacctgctcggagaggagaatggg
ggcttttgccagcaggacatgggggagtcatgccttctcccaccttcgggaagtacgagt
gctcacatgccctgggatgagttcccaagtgcagggcccaaggaggcacctccctggggc
aaggagcagcctctccacctggagccaagtcctcctgccagcccgacccagagtccagac
aacctgacttgcacagagacgcccctcgtcatcgcaggcaaccctgcttaccgcagcttc
agcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccacagctggcc
agacacctggaggaagtagaacccgagatgccctgtgtcccccagctctctgagccaacc
actgtgcccccacctgagccagaaacctgggagcagatcctccgccgaaatgtcctccag
catggggcagctgcagcccccgtctcggcccccaccagtggctatcgggagtttatacat
gcagtggagcagggtggcacccaggccagtgcggtggtgggcttgggtcccccaggagag
gctggttacaaggccttctcaagcctgcttgccagcagtgctgtgtccccggagaaatgt
gggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcctggc
tgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcacagtccgcagagctcacatctcccaagcagctccccagagcacctgggtctg
gagccgggggaaaaggtagaggacatgccaaagcccccacttccccaggagcaggccaca
gacccccttgtggacagcctgggcagtggcattgtctactcagccctcacctgccacctg
tgcggccacctgaaacagtgtcatggccaggaggatggtggccagacccctgtcgtggcc
agtccctgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctgagg
gccccagacccctctccaggtggggttccactggaggccagcctgtgtccggcctccctg
gcaccctcgggcatctcagagaagattaaaccctcatcgtccttccatcctgcccctggc
aatgctcagagctcaagccagacccccaaaatcgtgaactttgtctccgtgggacccaca
tacatgagggtctcttag

DBGET integrated database retrieval system