KEGG   Pan paniscus (bonobo): 100970129
Entry
100970129         CDS       T02283                                 

Gene name
KDM5C
Definition
(RefSeq) lysine demethylase 5C
  KO
K11446  [histone H3]-trimethyl-L-lysine4 demethylase [EC:1.14.11.67]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100970129 (KDM5C)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100970129 (KDM5C)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     100970129 (KDM5C)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100970129 (KDM5C)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    100970129 (KDM5C)
SSDB
Motif
Pfam: PLU-1 JmjC ARID JmjN PHD zf-C5HC2
Other DBs
NCBI-GeneID: 100970129
NCBI-ProteinID: XP_003805944
UniProt: A0A2R9BE67
Position
X
AA seq 1560 aa
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQQLKNCLSEAEACVSRALGLVSGQEAGP
HRVAGLQMTLTELRAFLDQMNNLPCAMHQIGDVKGVLEQVEAYQAEAREALASLPSSPGL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV
APSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIREAENIPVHLPNIQ
ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASSTTASSTTSVCVCGQVPAGAGAL
QCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQRLQAEPR
PEEPPNYPAAPASDPLREGSGKDMPKVQGLLENGDSVTSPEKVAPEEGSGKRDLELLSSL
LPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLEL
EKAERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE
ETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
NT seq 4683 nt   +upstreamnt  +downstreamnt
atggagccggggtccgacgatttcctaccgccaccggagtgcccggtgttcgagcctagc
tgggccgagttccgagaccctcttggctacatcgcgaaaatcaggcccatcgcagagaaa
tcgggcatttgcaagatccgcccacccgcggactggcagccaccctttgctgtggaagtg
gacaacttcaggtttaccccccgaatccagaggctgaatgagctagaggcccagacgaga
gtgaaactgaactacttggaccagattgccaaattctgggaaatccagggctcctcctta
aagattcccaatgtagaacggcggatcttggacctctacagtctcagcaaaattgtggtg
gaggaaggtggttatgaagctatctgcaaggaccgtcggtgggctcgggtagcccagcgc
ctcaactatccaccaggcaaaaatattggctccttgctacgctcccactacgaacgcatt
gtttatccctatgaaatgtaccagtctggagccaaccttgtgcagtgtaacacacgtcca
tttgataatgaggagaaggacaaggaatacaaaccccacagcatccccctacgacagtct
gtgcagccttccaagttcaacagctatggccggcgggccaagagactgcagcctgatccg
gaacccacagaggaagacattgaaaagaatccagagctgaaaaagctacagatctatggg
gcaggccccaagatgatgggcctgggcctcatggccaaagacaagactctgcggaagaaa
gataaggaggggcctgagtgtccccccacagtagtggtgaaggaggagttaggtggggat
gtgaaggtggagtcaacatcgcctaagaccttcctggagagcaaggaggagctgagtcac
agcccagaaccctgcaccaagatgaccatgaggctacggaggaaccacagcaatgcccag
tttattgagtcatatgtctgccggatgtgttctcgaggggatgaggatgacaagctcctg
ctgtgtgatggctgtgatgacaactaccacatcttctgcctgctgcctcctctgcctgag
atccccaagggtgtctggcggtgcccaaagtgtgtcatggcggagtgtaagcggccccca
gaagcctttggctttgagcaggctacccgggaatacactctgcagagctttggcgagatg
gccgactcctttaaagctgactacttcaacatgcccgtgcatatggtgcccacagaactt
gtggagaaggagttctggaggctggtaaatagcattgaggaagatgtgactgttgagtat
ggagctgacatccattccaaagaatttggcagcggtttccctgtcagtgacagtaaacgg
cacctaacccccgaagaggaggagtatgctaccagtggttggaacctaaatgtgatgccg
gtgttggaacagtctgtactgtgccacatcaatgcagatatctctggcatgaaggtgccc
tggctctacgtgggcatggtcttctcagccttttgctggcatattgaggatcactggagt
tactccattaactacctccactggggtgagccgaagacctggtatggggtgccctcactt
gcagcagaacatttggaagaagtgatgaagaagctgacacctgaactatttgatagccag
cctgacctcctgcaccaacttgtcaccctcatgaatcccaacaccctcatgtcccatggt
gtgccagttgtccgcacaaaccagtgtgcaggagaatttgtcatcaccttcccccgtgct
taccacagcggcttcaaccaaggctacaactttgccgaggctgtcaacttttgcactgct
gactggttgcctgctgggcgccagtgcattgagcactaccgccggctccggagatactgc
gtcttctcccatgaggagcttatctgcaagatggctgcctgcccagagaagctagaccta
aacctggcggcagctgtgcataaggagatgttcatcatggtgcaagaagagcggcgtcta
cgaaaggccctgctggagaagggtatcacagaggctgagcgagaggctttcgagctgctc
ccagatgatgagcgccagtgtatcaagtgcaagactacgtgtttcctgtcagccctggcc
tgctacgactgcccagacggccttgtctgcctttcccacatcaatgatctctgcaagtgc
tctagtagccggcagtacctgcggtatcggtataccttggatgagcttcctgccatgctg
cataagctgaaggttcgggctgagtcctttgacacctgggccaacaaagtgcgagtggcc
ctggaggtggaggatgggcggaagcgcagccttgaagaactgagggcactagagtctgaa
gcccgtgagcggaggtttcctaatagtgagctgctgcagcaactaaagaactgcctgagt
gaggcagaggcttgcgtgtcccgagctctgggactggtcagcggccaggaagctggcccc
cacagggtggctggtctacagatgaccctgactgagctccgggcctttctggaccagatg
aacaacctgccttgcgccatgcaccagattggggatgtcaagggtgttctggaacaggtg
gaggcctaccaggctgaggctcgtgaggccctggcctcactgccctccagtccagggcta
ctgcagtccctgttggagagggggcggcagctgggggtggaggtgcctgaggcccagcag
ctccagcggcaggtggaacaggcgcgatggctggatgaggtgaaacgcacactggccccc
tcagcccgaaggggcaccttggctgtcatgcgaggactgttggtcgcgggtgccagtgta
gcccctagccctgctgtggataaagcccaggccgagctgcaggaactgctgaccattgct
gaacgctgggaggagaaagcccacctctgcctggaggccaggcagaagcatccaccagcc
acacttgaggccataatccgtgaagcggaaaacatccctgttcacctgcccaacatccag
gctctcaaggaggctcttgctaaggcccgggcctggattgctgatgttgatgagatccaa
aatggtgaccactacccctgcctggatgacttggagggcctagtagctgtgggccgggac
ctacctgtggggctggaggagctgagacagctagagctacaggtactgacagcgcactcc
tggagggagaaggcctccaagaccttcctcaagaaaaattcttgctacacgctgctggag
gttctctgcccatgtgcagatgctggctcagacagcaccaagcgcagccggtggatggag
aaggagctgggattgtacaaatctgacacagagctgctggggctgtctgcgcaggacctc
agggacccaggctctgtgatcgtggccttcaaggagggggaacagaaggagaaggagggt
atcctgcagctgcgtcgcaccaattcggccaagcccagtccactggcatcatcgaccacg
gcctcctctacaacctctgtctgtgtgtgtgggcaggtgccggctggggcgggagctctg
cagtgtgacctgtgtcaggactggttccatgggcggtgtgtgtcagtgcctcgcctcctc
agctctccgaggcccaatcccacctcatccccactgctggcctggtgggaatgggacacc
aaattcctgtgtccactgtgtatgcgctcaaggcgcccgcgcctggagaccatcctggca
ctgctggtagccctgcagagactgcctgtgcggctgcccgagggcgaggccctgcagtgc
ctcacagagagggccatcagctggcaaggccgcgccaggcaggctctggcctctgaagat
gtgactgctcttttgggacggctggctgagctccgccaacggctacaggctgaacctaga
cctgaggagcctcctaactaccctgcagcccctgcttctgaccccctcagagagggcagt
ggcaaggatatgcctaaggtccagggcttactggagaatggagacagtgtgaccagtcct
gagaaggtagccccggaggagggctcaggtaagagagatctggagctgctgtcctcgctg
ttgccacagttgactggccctgtgttggaactgcctgaggcaacccgggcccccttggag
gagctcatgatggagggggacctgctcgaggtgaccctggatgagaaccacagcatctgg
cagctgctgcaggctggacagcccccagacctggagaggatccgcacacttctggagctg
gagaaggcagagcgtcacgggagtcgggctcggggccgggccctggagaggcggcggcgg
cggaaggtggatcggggtggggagggcgatgacccagcccgagaggagctagagccaaag
agggtacggagctcagggccagaggctgaggaggtccaggaggaggaagagctggaggag
gagactgggggtgagggcccccctgcacccatccccaccactggcagccccagcacccag
gagaaccagaatggcttggaaccggcggaagggaccacttcaggcccctcggcccctttc
tccactctgactccccggctgcatctgccctgcccacagcagccgcctcagcaacagttg
tga

DBGET integrated database retrieval system