KEGG   Pan paniscus (bonobo): 100972031
Entry
100972031         CDS       T02283                                 

Gene name
IL6R
Definition
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04066  HIF-1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04659  Th17 cell differentiation
pps04932  Non-alcoholic fatty liver disease
pps05163  Human cytomegalovirus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100972031 (IL6R)
   04066 HIF-1 signaling pathway
    100972031 (IL6R)
   04151 PI3K-Akt signaling pathway
    100972031 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100972031 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100972031 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100972031 (IL6R)
   04659 Th17 cell differentiation
    100972031 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972031 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100972031 (IL6R)
   05163 Human cytomegalovirus infection
    100972031 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100972031 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100972031 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100972031 (IL6R)
   04090 CD molecules [BR:pps04090]
    100972031 (IL6R)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IL6/12 receptor family
   100972031 (IL6R)
CD molecules [BR:pps04090]
 Proteins
  100972031 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_2 fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 100972031
NCBI-ProteinID: XP_003817158
UniProt: A0A2R9A372
Position
1
AA seq 468 aa
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSQTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPTQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgctctgctggccgcgccgggagcggcgctg
gccccaaggcgctgccctgcgcaggaggtggcgagaggtgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccgggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccaccccagcagatgggctggcatgggaaggagg
ctgctgttgaggtcggtgcagctccacgactctggaaactattcatgctaccgggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaacgttgtttgtgagtggggtcctcggagcacccca
tcccagacgaccaaggctgtgctcttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcccaggagtcccagaagttctcctgccagttggcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgtcgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgctgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacgccttggacagaatccaggagt
cctccagctgagaacgaggtgtccacccccacgcaggcacttactactaataaagacgat
gataatattctcttcagagattctgcaaatgcgacaagcctcccagtgcaagattcttct
tcagtaccactgcccacattcctggttgctggagggagcctggccttcggaacgctcctc
tgcattgccattgttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggc
aagacaagcatgcatccgccgtactctttggggcagctggtcccggagaggcctcgaccc
accccagtgcttgttcctctcatctccccaccggtgtcccccagcagcctggggtctgac
aatacctcgagccacaaccgaccagatgccagggacccacggagcccttatgacatcagc
aatacagactacttcttccccagatag

DBGET integrated database retrieval system