KEGG   Pan paniscus (bonobo): 100972241Help
Entry
100972241         CDS       T02283                                 

Gene name
DNAJA1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A1
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100972241 (DNAJA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pps03110]
    100972241 (DNAJA1)
   04131 Membrane trafficking [BR:pps04131]
    100972241 (DNAJA1)
Chaperones and folding catalysts [BR:pps03110]
 Heat shock proteins
  HSP40 / DNAJ
   100972241 (DNAJA1)
Membrane trafficking [BR:pps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    100972241 (DNAJA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Motif
Other DBs
NCBI-GeneID: 100972241
NCBI-ProteinID: XP_003830159
UniProt: A0A2R8ZXS2
Position
9
AA seq 397 aa AA seqDB search
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagaaacaacttactacgatgttttgggggtcaaacccaatgctactcaggaa
gaattgaaaaaggcttataggaaactggccttgaagtaccatcctgataagaatccaaat
gaaggagagaagtttaaacagatttctcaagcttacgaagttctctctgatgcaaagaaa
agggaattatatgacaaaggaggagaacaggcaattaaagagggtggagcaggtggcggt
tttggctcccccatggacatctttgatatgttttttggaggaggaggaaggatgcagaga
gaaaggagaggtaaaaatgttgtacatcagctctcagtaaccctagaagacttatataat
ggtgcaacaagaaaactggctctgcaaaagaatgtgatttgtgacaaatgtgaaggtaga
ggaggtaagaaaggagcagtagagtgctgtcccaattgccgaggtactggaatgcaaata
agaattcatcagataggacctggaatggttcagcaaattcagtctgtgtgcatggagtgc
cagggccatggggagcggatcagtcctaaagatagatgtaaaagctgcaacggaaggaag
atagttcgagagaagaaaattttagaagttcatattgacaaaggcatgaaagatggccag
aagataacattccatggtgaaggagaccaagaaccaggactggagccaggcgatattatc
attgtgttagatcagaaggaccatgctgtttttactcgacgaggagaagaccttttcatg
tgtatggacatacagctcgttgaagcattgtgtggcttccagaagccaatatctactctt
gacaaccgaaccatcgtcatcacctctcatccaggtcagattgtcaagcatggagatatc
aagtgtgtactaaatgaaggcatgccaatttatcgtagaccatatgaaaagggtcgccta
atcatcgaatttaaggtaaactttcctgagaatggctttctctctcctgataaactgtct
ttgctggaaaaactcctacccgagaggaaggaagtggaagagactgatgagatggatcaa
gtagaactggtggactttgatccaaatcaggaaagacggcgccactacaatggagaagca
tatgaggatgatgaacatcatcccagaggtggtgttcagtgtcagacctcttaa

DBGET integrated database retrieval system