KEGG   Pan paniscus (bonobo): 100972867
Entry
100972867         CDS       T02283                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04210  Apoptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04926  Relaxin signaling pathway
pps04931  Insulin resistance
pps05132  Salmonella infection
pps05134  Legionellosis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05215  Prostate cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100972867 (NFKBIA)
   04668 TNF signaling pathway
    100972867 (NFKBIA)
   04024 cAMP signaling pathway
    100972867 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100972867 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100972867 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100972867 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100972867 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100972867 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100972867 (NFKBIA)
   04660 T cell receptor signaling pathway
    100972867 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100972867 (NFKBIA)
   04659 Th17 cell differentiation
    100972867 (NFKBIA)
   04657 IL-17 signaling pathway
    100972867 (NFKBIA)
   04662 B cell receptor signaling pathway
    100972867 (NFKBIA)
   04062 Chemokine signaling pathway
    100972867 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100972867 (NFKBIA)
   04926 Relaxin signaling pathway
    100972867 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100972867 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100972867 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972867 (NFKBIA)
   05203 Viral carcinogenesis
    100972867 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100972867 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100972867 (NFKBIA)
   05215 Prostate cancer
    100972867 (NFKBIA)
   05222 Small cell lung cancer
    100972867 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100972867 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100972867 (NFKBIA)
   05161 Hepatitis B
    100972867 (NFKBIA)
   05160 Hepatitis C
    100972867 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    100972867 (NFKBIA)
   05164 Influenza A
    100972867 (NFKBIA)
   05162 Measles
    100972867 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100972867 (NFKBIA)
   05163 Human cytomegalovirus infection
    100972867 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100972867 (NFKBIA)
   05169 Epstein-Barr virus infection
    100972867 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100972867 (NFKBIA)
   05135 Yersinia infection
    100972867 (NFKBIA)
   05134 Legionellosis
    100972867 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100972867 (NFKBIA)
   05140 Leishmaniasis
    100972867 (NFKBIA)
   05142 Chagas disease
    100972867 (NFKBIA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100972867 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100972867 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100972867 (NFKBIA)
   04131 Membrane trafficking [BR:pps04131]
    100972867 (NFKBIA)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100972867 (NFKBIA)
Membrane trafficking [BR:pps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100972867 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100972867
NCBI-ProteinID: XP_008972919
Position
14
AA seq 491 aa
MVQHSPHYRGDSEDGRKRMVREECLKCLQSNQALAMLLFPWGSKNGKDRQVGKPQRGTAH
QVGVLGISAADDPNSNRSWETPGKEGSLAEGQDYRVQAAGKYRGEGAWSEGLSSHSTLIK
KFPQRTKPVLFFWSDWLGNSPSLTPPQRNPQPAFIGRRGGAAEPTPVRAAVPPASAPVRK
HPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGAEPW
KQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEI
AEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTC
LHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRV
TYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYD
DCVFGGQRLTL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggtacaacacagcccgcactaccgtggggacagtgaagatggaaggaagaggatggtc
cgggaggagtgcctgaagtgcctgcagtcaaaccaggccctggcgatgctccttttccca
tggggatcaaaaaacggaaaggaccggcaggttggcaaaccccaaagagggaccgcccat
caggtcggcgtccttgggatctcagcagccgacgaccccaattcaaatcgatcttgggaa
accccagggaaagaaggttcacttgcagagggacaggattacagggtgcaggctgcaggg
aagtaccggggggagggagcctggtcggaaggactttccagccactcgacgctcatcaaa
aagttccctcagaggacgaagccagttctctttttctggtctgactggcttggaaattcc
ccgagcctgaccccgccccagagaaatccccagccagcgtttatagggcgccgcggcggc
gctgcagagcccacaccagtccgtgccgccgtcccgcccgccagcgccccagtgaggaag
cacccccaggagtgggccatggagggcccccgcgacgggctgaagaaggagcggctactg
gacgaccgccacgacagcggcctggactccatgaaagacgaggagtacgagcagatggtc
aaggagctgcaggagatccgcctcgagccgcaggaggtgccgcgcggcgcggagccctgg
aagcagcagctcaccgaggacggggactcgttcctgcacttggccatcatccatgaagaa
aaggcactgaccatggaagtgatccgccaggtgaagggagacctggccttcctcaacttc
cagaacaacctgcagcagactccactccacttggctgtgatcaccaaccagccagaaatt
gctgaggcacttctgggagctggctgtgatcctgagctccgagactttcgaggaaatacc
cccctacaccttgcctgtgagcagggctgcctggccagcgtgggagtcctgactcagtcc
tgcaccaccccgcacctccactccatcctgaaggctaccaactacaatggccacacgtgt
ctacacttagcctctatccatggctacctgggcatcgtggagcttttggtgtccttgggt
gctgatgtcaatgctcaggagccctgtaatggccggactgcccttcacctcgcagtggac
ctgcagaatcctgacctggtgtcactcctgttgaagtgtggggctgatgtcaacagagtt
acctaccagggctattctccctaccagctcacctggggccgcccaagcacccggatacag
cagcagctgggccagctgacactagaaaaccttcagatgctgccagagagtgaggatgag
gagagctatgacacagagtcagagttcacggagttcacagaggacgagctgccctatgat
gactgtgtgtttggaggccagcgtctgacgttatga

KEGG   Pan paniscus (bonobo): 100975775
Entry
100975775         CDS       T02283                                 

Gene name
NFKBIE
Definition
(RefSeq) NFKB inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04722  Neurotrophin signaling pathway
pps04920  Adipocytokine signaling pathway
pps05169  Epstein-Barr virus infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100975775 (NFKBIE)
   04658 Th1 and Th2 cell differentiation
    100975775 (NFKBIE)
   04659 Th17 cell differentiation
    100975775 (NFKBIE)
   04662 B cell receptor signaling pathway
    100975775 (NFKBIE)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100975775 (NFKBIE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100975775 (NFKBIE)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100975775 (NFKBIE)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100975775 (NFKBIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100975775 (NFKBIE)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100975775 (NFKBIE)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5
Other DBs
NCBI-GeneID: 100975775
NCBI-ProteinID: XP_003833276
Position
6
AA seq 500 aa
MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGATRVRRPCWPGGAGRG
GGPAWAVRLPTVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAAR
RSLEPDPAQTGPRPARAAGMSEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPS
DGSPQPCTHPPGPAKEPQEKEDADGERADSTYGSSSLTETLSLLGGPEAEDPAPRLPLPH
XGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHL
AVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTSHS
LDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
LVLLPFDDLKISGKLLLCTD
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaatcaacgaaggagtgagtcaaggcccgggaaccacagactccaagcctacgcagag
cccgggaagggggattccggaggggcggggcctctttccggaagcgcccgccgggggcgg
ggagggggcggggccacccgcgtgaggcgaccctgttggcccggaggggcggggcgagga
ggaggacccgcttgggcggttcggctgcccacagtaaccgctgggtggacctggccagcg
ctccgaaccttgtcctcgctgcgcgccggcccctcggagccccacagcccgggaaggagg
ccgccgcgggccgggcgcccgctctgccaagcggacccgcaacccggaaaggcggcgcgg
cggagcctggagccggatcctgctcagaccgggccccggccggccagagccgcgggcatg
tcggaggcgcggaaggggccggacgaggcggaggagagccagtacgactctggcattgag
tctctgcgctctctgcgctccctacccgagtccacctcggctccagcctccgggccctcg
gacggcagcccccagccctgcacccatcctccggggcccgccaaggaaccacaggagaag
gaagacgcggatggggagcgggctgattccacctatggctcctcctcgctcaccgagacc
ctgtccttgctggggggccccgaggctgaggacccggccccacgcctgccactcccccac
ngtggggcgctgagccctcagcagctggaagcactcacttacatctccgaggacggagac
acgctggtccacctggcagtgattcatgaggccccagcggtgctgctctgttgcctggct
ttgctgccccaggaggtcctggacattcaaaataacctttaccagacagcactccatctg
gctgtacatctggaccaaccgggcgcagttcgggcactggtgctgaagggggccagccgg
gcactacaggaccggcatggtgacacagcccttcatgtggcctgccagcggcagcacttg
gcctgtgcccgctgcctgctggaggggcggccagagccaggcagaggaacatctcactct
ctggacctccagctgcaaaactggcaaggtctggcttgtctccacattgccacccttcag
aagaaccaaccactcatggaactgctgcttcggaatggagctgacattgatgtgcaggag
ggcaccagtggtaagacagcgctgcacctggctgtggaaacccaagagcggggcctggta
cagttcctgctccaggctggtgcccaggtagatgcccgcatgctgaacgggtgcacaccc
ctgcacctggcagctggccggggtctcatgggcatctcatccactctgtgcaaggcgggt
gctgactccctgctgcggaatgtggaggatgagacgccccaggacctgactgaggaatcc
cttgtccttttgccctttgatgacctgaagatctcagggaaactgctgctgtgtaccgac
tga

KEGG   Pan paniscus (bonobo): 100980612
Entry
100980612         CDS       T02283                                 

Gene name
NFKBIB
Definition
(RefSeq) NFKB inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04062  Chemokine signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04722  Neurotrophin signaling pathway
pps04920  Adipocytokine signaling pathway
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05162  Measles
pps05164  Influenza A
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100980612 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    100980612 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    100980612 (NFKBIB)
   04660 T cell receptor signaling pathway
    100980612 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    100980612 (NFKBIB)
   04659 Th17 cell differentiation
    100980612 (NFKBIB)
   04662 B cell receptor signaling pathway
    100980612 (NFKBIB)
   04062 Chemokine signaling pathway
    100980612 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100980612 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100980612 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100980612 (NFKBIB)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100980612 (NFKBIB)
   05164 Influenza A
    100980612 (NFKBIB)
   05162 Measles
    100980612 (NFKBIB)
   05169 Epstein-Barr virus infection
    100980612 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100980612 (NFKBIB)
   05140 Leishmaniasis
    100980612 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100980612 (NFKBIB)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100980612 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 100980612
NCBI-ProteinID: XP_003812307
Position
19
AA seq 356 aa
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPDPV
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctggggtcgcgtgcttgggaaaagctgcggacgcagatgaatggtgcgacagcggc
ctgggctccctgggtccggacgcagcggcccccggaggacctgggttgggcgcggagttg
ggcccggggctgtcgtgggctcccctcgtcttcggctacgtcactgaggatggggacacg
gcactgcacttggctgtgattcatcagcatgaacccttcctggattttcttctaggcttc
tcggccggcactgagtacatggacctgcagaatgacctaggccagacagccctgcacctg
gcagccatcctgggggaggcatccacggtggagaagctgtatgcagcaggcgccgggctg
tgcgtggcggagcgtaggggccacacggcgctgcacctggcctgccgtgtgggggcacac
gcctgtgcccgtgccctgcttcagccccgcccccggcgccccagggaagcccccgacacc
tacctcgctcagggccctgaccgtactcccgacaccaaccacacccctgtcgccttgtac
cccgattccgacttggagaaggaagaagaggagagtgaggaggactggaagctgcagctg
gaggctgaaaactatgagggccacaccccactccacgtggccgttatccacaaagatgtg
gagatggtccggctgctccgagatgctggagctgaccttgacaaaccggagcccacgtgc
ggccggagcccccttcatttggcagtggaggcccaggcggccgatgtgctggagcttctc
ctgagggcaggcgcgaaccctgctgcccgcatgtacggcggccgcaccccactcggcagt
gccatgctccggcccaaccccatcctcgcccgcctcctccgtgcacacggagcccctgag
cccgagggcgaggacgagaaatccggcccctgcagcagcagtagcgacagcgacagcgga
gacgagggcgatgaatacgacgacattgtggttcacagcagccgcagccaaacccggctg
cctcccaccccagcctcaaaacctcttcctgacgaccccgaccccgtctga

DBGET integrated database retrieval system